DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and Ras85D

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:195 Identity:69/195 - (35%)
Similarity:109/195 - (55%) Gaps:21/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAM 82
            :|::||.||||||||:|.::.|:..|.:.|.|||||:||:.:..:...|.|.|.||.|..::.||
  Fly     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67

  Fly    83 QRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCD------ETAEL 141
            :...:..|..|:||::|.|.:|.|::......||.:|.|:  .:|::|||||||      ...:.
  Fly    68 RDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAE--EVPMVLVGNKCDLASWNVNNEQA 130

  Fly   142 REVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206
            |||::..|        |.::||||||...|.:.|..|:     |.:....|.|.::.:|..|.::
  Fly   131 REVAKQYG--------IPYIETSAKTRMGVDDAFYTLV-----REIRKDKDNKGRRGRKMNKPNR 182

  Fly   207  206
              Fly   183  182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 64/170 (38%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 65/175 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.