DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and CG14669

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:218 Identity:50/218 - (22%)
Similarity:83/218 - (38%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RVVVFGAGGVGKSSLVLRFIKGTF-RESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAMQ 83
            :....||.||||:|::.:|....| |.....|....|:..:.|:..|..|.:.|.....:|||..
  Fly    96 KAAFLGATGVGKTSILQQFFYHDFPRTHQTTTHRKIYKNCLVCDTCIRELMVLDVPPQKRFPADN 160

  Fly    84 RLSISKG--------HAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAE 140
            ....:.|        ||::|||.:.:.::.:..|.:...|  |......:..:::||||.|...|
  Fly   161 FAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQI--LDSFSHRDFSIIVVGNKFDNVTE 223

  Fly   141 LREVSQAEGQAQATT---WSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKE 202
            .:..||.........   |...::|.||:.|:.:.::|:||:                       
  Fly   224 AQANSQELKDISTLVRKHWRCGYVECSAQYNYKIGDVFRELM----------------------- 265

  Fly   203 KKSKDTNGSIPENGDAGASASGG 225
                   |.....|..||...||
  Fly   266 -------GCTSAVGGGGAGGGGG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 44/174 (25%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 44/202 (22%)
small_GTPase 96..265 CDD:197466 43/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.