DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and CG8641

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster


Alignment Length:237 Identity:80/237 - (33%)
Similarity:115/237 - (48%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            |...|.||:|:.|:...||||:|.||:...|.|:|.||||:.:|::......:..|.|.||:|.|
  Fly   161 PSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYH 225

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEE--------LRPIWALIKE---LKGADIPNIPVMLV 131
            .||||:|||...|..||||:|:.|::|.||        |...||.:..   .|...:|.||::|.
  Fly   226 PFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILA 290

  Fly   132 GNKCDETAELREVSQAEGQAQATTWSISFMETSAKTNHNVTELFQEL-----LNMEKT-----RT 186
            |||||...:..:|.:..|.........:|:|.||:.|:.:.:||..|     |.:|.|     |.
  Fly   291 GNKCDRDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRL 355

  Fly   187 VSLQLDTKKQKKQKKEKKSKDTNGSIPENGDAGASASGGAKE 228
            ||:                ......:|.:|    ||.||.|:
  Fly   356 VSV----------------FGAPSPLPPHG----SAVGGTKK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 66/180 (37%)
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 78/231 (34%)
RAS 167..338 CDD:214541 64/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113652at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.