DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and Ric

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:181 Identity:61/181 - (33%)
Similarity:98/181 - (54%) Gaps:5/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAMQ 83
            |::|:.|.||||||::.|:|:..:|.:.:.|||||:|:|....:.....|.|.||.|..:|.||:
  Fly    60 YKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMR 124

  Fly    84 RLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREVSQAE 148
            ...:..|..||:.|||..:.|.:|......||..::.::  :||::|:.||.|..:: |.|:..|
  Fly   125 DQYMRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSE--DIPLVLIANKVDLESQ-RRVTTEE 186

  Fly   149 GQAQATTWSISFMETSAKTNHNVTELFQELLN--MEKTRTVSLQLDTKKQK 197
            |:..|..:...|.||||...|.:.|.|..|:.  ..|....:|..|:..:|
  Fly   187 GRNLANQFGCPFFETSAALRHYIDEAFYTLVREIRRKEMHKALGTDSNSEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 57/165 (35%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 58/171 (34%)
small_GTPase 58..223 CDD:197466 57/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.