DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and Diras1

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001102457.1 Gene:Diras1 / 366826 RGDID:1310445 Length:198 Species:Rattus norvegicus


Alignment Length:194 Identity:141/194 - (72%)
Similarity:164/194 - (84%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||||||||||||||||||||||||||:|||||::|||||||||||||||:|::||||||||||||
  Rat     2 PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSH 66

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            |||||||||||||||||||:||.|||||:||.||:.||.::||: :.:||:||||||||||.  |
  Rat    67 QFPAMQRLSISKGHAFILVFSVTSKQSLDELSPIYKLIVQIKGS-VEDIPIMLVGNKCDETQ--R 128

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206
            ||...|.||.|..|..:|||||||.|:||.|||||||.:|..|:|||.:|.|:..|||:..:.|
  Rat   129 EVHTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRSVSLSVDGKRSNKQKRADRIK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 125/164 (76%)
Diras1NP_001102457.1 P-loop_NTPase 7..168 CDD:422963 125/163 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 250 1.000 Domainoid score I2043
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2623
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm46084
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.