DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and diras1a

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_956125.1 Gene:diras1a / 327577 ZFINID:ZDB-GENE-030131-5788 Length:195 Species:Danio rerio


Alignment Length:221 Identity:141/221 - (63%)
Similarity:168/221 - (76%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||||||||||||||||||||||||||:|||||::||||:||||||||||:|::|||:||||||||
Zfish     2 PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTVEDTYRQVISCDKSVCTLEITDTTGSH 66

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            |||||||||||||:|||||||:.|:||||||:||:..:..:|| ::.|||:||||||.|||.  |
Zfish    67 QFPAMQRLSISKGYAFILVYSITSRQSLEELKPIYQQVLAIKG-NVENIPIMLVGNKSDETQ--R 128

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSKD 207
            ||...||:|||.||..:|||||||||.||.||||||||::|.|.:||.:.:.||::..|      
Zfish   129 EVETKEGEAQANTWKCAFMETSAKTNTNVKELFQELLNLDKKRDMSLNMRSSKQRRADK------ 187

  Fly   208 TNGSIPENGDAGASASGGAKEKCRVM 233
                              .|.||.||
Zfish   188 ------------------LKAKCSVM 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 124/164 (76%)
diras1aNP_956125.1 P-loop_NTPase 7..169 CDD:304359 124/164 (76%)
RAS 20..171 CDD:214541 112/153 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I2029
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 290 1.000 Inparanoid score I2785
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm25076
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.