DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and Rala

DIOPT Version :10

Sequence 1:NP_649948.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:68 Identity:12/68 - (17%)
Similarity:22/68 - (32%) Gaps:21/68 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SALVIFLLAIRTQASLFDPSQSDVSLFDRLRLETDLRNGASLIREILESKTNNAQLQDLERLTEH 74
            |:..|::..:.|.....:|:....:..|                .:...||.|     ...::||
  Fly   208 SSTPIYITKVPTTFERSEPTMGTEATTD----------------PVFPDKTTN-----FATVSEH 251

  Fly    75 YRS 77
            .||
  Fly   252 SRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_649948.1 ARHI_like 18..183 CDD:206711 10/60 (17%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.