DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and CG13375

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:248 Identity:83/248 - (33%)
Similarity:126/248 - (50%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QKNQVTRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTL 68
            :.|.|..|....:..:::||.|:..|||:|::.:|:..||...|..|||:.::...|......||
  Fly    33 RNNAVDDAIGPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTL 97

  Fly    69 QITDTTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGN 133
            .|.||.||::||||:.||||...||||||.|....:.||:|.|...|.|.|....  :|:::|||
  Fly    98 DILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTA--VPIVVVGN 160

  Fly   134 KCDETAE---LREVSQAEGQAQATT-WSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTK 194
            |.|..|:   .|||..|..::..|. |...|:|.||.:|.|:|::|:|||...|   ::..|...
  Fly   161 KIDLLADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAK---ITYNLSPA 222

  Fly   195 KQKKQKKEKKSKDTNG-SIP--------------------ENGDAGASASGGA 226
            .:::::...:....|| |.|                    .:..|.||:|||:
  Fly   223 LRRRRQSLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGGS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 68/168 (40%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 69/171 (40%)
Ras_dva 49..239 CDD:206714 71/194 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113652at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.