DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and drn-1

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001333544.2 Gene:drn-1 / 183765 WormBaseID:WBGene00016911 Length:219 Species:Caenorhabditis elegans


Alignment Length:195 Identity:124/195 - (63%)
Similarity:150/195 - (76%) Gaps:2/195 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCN-KNICTLQITD 72
            ::.|...::||||.|||||||||||:..||:||||.|:|:|||||||||||||| ||:|||||||
 Worm    21 SKVAEASTSDYRVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYRQVISCNQKNVCTLQITD 85

  Fly    73 TTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDE 137
            ||||||||||||||||||:||||:|||.:|||..||.||..::||:||..|...|:||||||.||
 Worm    86 TTGSHQFPAMQRLSISKGNAFILIYSVTNKQSFAELVPIIEMMKEVKGNAIAETPIMLVGNKKDE 150

  Fly   138 TAELREVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKE 202
            .:: ||||...||..||.....|:|||||.|.|:|||||:||.:||.|.::|.:|....|..||:
 Worm   151 ESK-REVSSNSGQKVATNMECGFIETSAKNNENITELFQQLLALEKKRQLALTMDDPDGKNGKKK 214

  Fly   203  202
             Worm   215  214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 115/165 (70%)
drn-1NP_001333544.2 P-loop_NTPase 30..195 CDD:328724 115/165 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I1537
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I2102
Isobase 1 0.950 - 0 Normalized mean entropy S634
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - oto20820
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5443
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.