DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and DIRAS1

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_011526015.1 Gene:DIRAS1 / 148252 HGNCID:19127 Length:232 Species:Homo sapiens


Alignment Length:194 Identity:142/194 - (73%)
Similarity:163/194 - (84%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||||||||||||||||||||||||||:|||||::|||||||||||||||:|::||||||||||||
Human    36 PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSH 100

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            |||||||||||||||||||:||.||||||||.||:.||.::||: :.:|||||||||||||.  |
Human   101 QFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGS-VEDIPVMLVGNKCDETQ--R 162

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206
            ||...|.||.|..|..:|||||||.|:||.|||||||.:|..|.:||.:|.|:..|||:..:.|
Human   163 EVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 127/164 (77%)
DIRAS1XP_011526015.1 PTZ00369 39..232 CDD:240385 139/191 (73%)
P-loop_NTPase 41..202 CDD:304359 127/163 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 250 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2714
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm41946
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5443
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.