DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and diras3

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001107372.1 Gene:diras3 / 100135197 XenbaseID:XB-GENE-978992 Length:198 Species:Xenopus tropicalis


Alignment Length:194 Identity:149/194 - (76%)
Similarity:167/194 - (86%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||.|||||||||||.|||||||||||::|||||:|||||||||||||||:|||||||||||||||
 Frog     2 PEPSNDYRVVVFGAAGVGKSSLVLRFVRGTFRETYIPTIEDTYRQVISCDKNICTLQITDTTGSH 66

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            ||||||||||||||||||||||.||||:|||:||:..|.::|| |..|||:||||||.|||  ||
 Frog    67 QFPAMQRLSISKGHAFILVYSVTSKQSMEELQPIYEQICQIKG-DTQNIPIMLVGNKSDET--LR 128

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206
            ||..:||:..|..|..||||||||.|:||.||||||||:||.||||||:|.||.|::||:.|.|
 Frog   129 EVQASEGECLANKWKCSFMETSAKLNYNVQELFQELLNLEKRRTVSLQVDGKKSKQKKKKDKLK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 129/164 (79%)
diras3NP_001107372.1 ARHI_like 7..169 CDD:206711 129/164 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 248 1.000 Domainoid score I2093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2688
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm49168
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5443
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.