DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MtnA and MT2A

DIOPT Version :10

Sequence 1:NP_524299.1 Gene:MtnA / 41202 FlyBaseID:FBgn0002868 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_187550.1 Gene:MT2A / 820098 AraportID:AT3G09390 Length:81 Species:Arabidopsis thaliana


Alignment Length:78 Identity:19/78 - (24%)
Similarity:22/78 - (28%) Gaps:47/78 - (60%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CPCGSGCKC------------------------------------------ASQATKGSCNCGSD 25
            |.|||||||                                          ::.|...:|.||||
plant     8 CGCGSGCKCGNGCGGCKMYPDLGFSGETTTTETFVLGVAPAMKNQYEASGESNNAENDACKCGSD 72

  Fly    26 CKCGGDKKSACGC 38
            |||     ..|.|
plant    73 CKC-----DPCTC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtnANP_524299.1 Metallothio_5 1..40 CDD:280273 19/78 (24%)
MT2ANP_187550.1 Metallothio_2 7..80 CDD:396155 18/76 (24%)

Return to query results.
Submit another query.