DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ZNF394

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_115540.2 Gene:ZNF394 / 84124 HGNCID:18832 Length:561 Species:Homo sapiens


Alignment Length:290 Identity:86/290 - (29%)
Similarity:120/290 - (41%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 NTDLLQEHRCTSF---HYFPRL------NENGKKLLLPCDFCDVNFEFA--HDFLAHSEEK---- 489
            |.:|....||::.   .:.|:.      .|:|.|       |..:|...  |....|..:.    
Human   283 NNELQNSARCSNLVLCQHIPKAERPTDSEEHGNK-------CKQSFHMVTWHVLKPHKSDSGDSF 340

  Fly   490 -HLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIR 553
             |.:..:.:::....     |.|.|..||||:.|.|.|::|.|.|.|.||:.|||  |.:.|:..
Human   341 HHSSLFETQRQLHEE-----RPYKCGNCGKSFKQRSDLFRHQRIHTGEKPYGCQE--CGKSFSQS 398

  Fly   554 PDLNDHIRKCHTGERPYLCLVCGKRFLTG---------------------------SVFYQHRLI 591
            ..|..| ::.||||:||.||.||:||...                           |..::|:.:
Human   399 AALTKH-QRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCEECGETCHISNLFRHQRL 462

  Fly   592 HRGERRYECEE----------------------------CGKRFYRADALKNHQRIHTGEKPYSC 628
            |:|||.|:|||                            |||||.::..|..|||||||||||.|
Human   463 HKGERPYKCEECEKSFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQRIHTGEKPYKC 527

  Fly   629 LFCTKTFRQRGDRDKHIRARHSHLDANSRL 658
            |.|.:.|||    ..|: .||..:..|..|
Human   528 LECGERFRQ----STHL-IRHQRIHQNKVL 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 4/15 (27%)
COG5048 <450..647 CDD:227381 78/267 (29%)
C2H2 Zn finger 469..490 CDD:275368 4/27 (15%)
zf-C2H2 511..533 CDD:278523 11/21 (52%)
C2H2 Zn finger 513..564 CDD:275368 21/50 (42%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 14/25 (56%)
C2H2 Zn finger 572..592 CDD:275368 8/46 (17%)
zf-H2C2_2 585..609 CDD:290200 14/51 (27%)
zf-C2H2 598..620 CDD:278523 13/49 (27%)
C2H2 Zn finger 600..620 CDD:275368 12/47 (26%)
zf-H2C2_2 612..637 CDD:290200 16/24 (67%)
C2H2 Zn finger 628..646 CDD:275368 7/17 (41%)
ZNF394NP_115540.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
SCAN 60..170 CDD:128708
KRAB_A-box 155..214 CDD:322003
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..285 1/1 (100%)
C2H2 Zn finger 337..353 CDD:275368 1/15 (7%)
COG5048 356..>420 CDD:227381 31/66 (47%)
C2H2 Zn finger 360..380 CDD:275368 10/19 (53%)
C2H2 Zn finger 388..408 CDD:275368 7/22 (32%)
zf-C2H2 414..436 CDD:306579 7/21 (33%)
C2H2 Zn finger 416..436 CDD:275368 6/19 (32%)
C2H2 Zn finger 444..463 CDD:275368 2/18 (11%)
SFP1 <464..543 CDD:227516 31/83 (37%)
C2H2 Zn finger 471..491 CDD:275368 3/19 (16%)
C2H2 Zn finger 499..519 CDD:275368 9/19 (47%)
C2H2 Zn finger 527..547 CDD:275368 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.