DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and AT3G29340

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:668 Identity:139/668 - (20%)
Similarity:217/668 - (32%) Gaps:205/668 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MKIRDFLAGVTSSKMTTEQSVFHGSRSNSSASTVNRIKCPTCLVQFDAV-AFQNHSCEAKPIEVA 164
            :.:|:.::.....|.||...|. ..|||..:.:.:  ||..|...|:.. |...|....:||:..
plant    10 LDLREMVSQSGFEKSTTCSGVI-ALRSNLQSKSSH--KCKICGKSFECYQALGGHQRIHRPIKEK 71

  Fly   165 VPQQEKPHLVPTVSAPPAPLSK-PASERVIRENQV---------------RLRRYIKDEM--KYD 211
            :.:||...:.|..|    .|.| |.|.....|.:|               :|.|..|.|:  ..|
plant    72 LSKQEFSEVYPRKS----KLQKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQD 132

  Fly   212 LATGIESSR-KNAAKGPNECTMC-DRKFVHASGLVRHMEK---HALDLIPS--QTSEQPHTIPAA 269
            ..:.::||. |.....|:...:. :.||:|...|.:...:   |: ..:||  ::..|..|...:
plant   133 ENSLLDSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPLSHS-GALPSTLRSKLQTKTQWKS 196

  Fly   270 GLHVVVKCNSCGRIFYDPQVAFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDP 334
            ..|    |..||:.|...|....|..:|                  |....:|....:...|.:|
plant   197 SCH----CKICGKSFVCSQGLGNHKRVH------------------REISGKLACKRKYTEDYNP 239

  Fly   335 AFATSNQNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNT 399
             |:.|.:.....||.  ||..:....:...|..:..|..|||.||...      :..:|...:..
plant   240 -FSDSLKAKKIVKKP--SSFEVSQEEKILHCVELKQDFGELLAHSGFD------KSISCSKSIKV 295

  Fly   400 AKEASIHFQTD------CIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEH-RCTSFHYFPR 457
            .|.|..:.:|:      .:|:.|..:.|:       .|..|..||.....:..| |..|.::...
plant   296 KKVARKNEKTEDSTSLFGVFVGEMSQRLH-------GCKTCGRKFGTLKGVYGHQRMHSGNHNRI 353

  Fly   458 LNENG-------KKLLLPCDFCDVNFEFAHDFLAHSEEKH------LN----------------- 492
            .:|||       ||....|.....:......|:|.. |||      ||                 
plant   354 EDENGLERIWGLKKKSRVCSVSAFDRFKGSSFMAEI-EKHEVIEAALNLVMLCQGVYDFASISNL 417

  Fly   493 ----------------KKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQ------- 534
                            ::|.:|::|::       |.|.||.||:..|..|..|.|.|:       
plant   418 PLGDGFMDLELKPCPLRRKLQKKSRSS-------YKCSICEKSFVCSQALGSHQRLHRWKLVPKP 475

  Fly   535 -------------GVKPFV--------CQEE---NCDRKFTIRPDLNDHIRKCHTGERPYLCLVC 575
                         ..|..|        .|||   .|     :.|.|..|.:..|:|...:  ..|
plant   476 EYIEDDSSLLDSSEAKKIVSKPSSFEHAQEEKILQC-----VEPKLEFHEQLAHSGFDKF--DTC 533

  Fly   576 GK-RFL----------------TGSVFYQHRLIHRGERRYECEE-----------------CGKR 606
            .| ||.                :..|....::::|.|.:....|                 |||.
plant   534 SKIRFSALPSPPEAKKIVSQPPSFEVSVDEKILYRAEPKLNFSEPLAHSCFDNSSSYRSIICGKS 598

  Fly   607 FYRADALKNHQRIHTGEK 624
            |..:.||..||.:|...|
plant   599 FVCSQALGGHQTLHRSIK 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 4/23 (17%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..453 CDD:275368 7/22 (32%)
COG5048 <450..647 CDD:227381 57/286 (20%)
C2H2 Zn finger 469..490 CDD:275368 4/20 (20%)
zf-C2H2 511..533 CDD:278523 10/21 (48%)
C2H2 Zn finger 513..564 CDD:275368 19/81 (23%)
C2H2 Zn finger 541..561 CDD:275368 7/22 (32%)
zf-H2C2_2 555..581 CDD:290200 8/42 (19%)
C2H2 Zn finger 572..592 CDD:275368 5/36 (14%)
zf-H2C2_2 585..609 CDD:290200 7/40 (18%)
zf-C2H2 598..620 CDD:278523 9/38 (24%)
C2H2 Zn finger 600..620 CDD:275368 9/36 (25%)
zf-H2C2_2 612..637 CDD:290200 6/13 (46%)
C2H2 Zn finger 628..646 CDD:275368
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 6/26 (23%)
C2H2 Zn finger 45..65 CDD:275368 5/19 (26%)
C2H2 Zn finger 100..120 CDD:275368 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.