Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079600.1 | Gene: | Zfp524 / 66056 | MGIID: | 1916740 | Length: | 321 | Species: | Mus musculus |
Alignment Length: | 250 | Identity: | 60/250 - (24%) |
---|---|---|---|
Similarity: | 88/250 - (35%) | Gaps: | 77/250 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 504 GAGRIR-QYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGE 567
Fly 568 RPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCT 632
Fly 633 KTFRQRGDRDKHIRARHSHL------------------DANSRLMMQ--MQKFQLE--------- 668
Fly 669 ---------TAAAQKAQSHNPEQQDNDVAGGASTSD-------VPSGSGFMSTEP 707 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
C2H2 Zn finger | 277..297 | CDD:275368 | |||
C2H2 Zn finger | 431..453 | CDD:275368 | |||
COG5048 | <450..647 | CDD:227381 | 41/143 (29%) | ||
C2H2 Zn finger | 469..490 | CDD:275368 | |||
zf-C2H2 | 511..533 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 513..564 | CDD:275368 | 10/50 (20%) | ||
C2H2 Zn finger | 541..561 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 555..581 | CDD:290200 | 4/25 (16%) | ||
C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 585..609 | CDD:290200 | 9/23 (39%) | ||
zf-C2H2 | 598..620 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 600..620 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 612..637 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 628..646 | CDD:275368 | 4/17 (24%) | ||
Zfp524 | NP_079600.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..80 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..105 | 2/3 (67%) | |||
COG5048 | <102..218 | CDD:227381 | 41/146 (28%) | ||
C2H2 Zn finger | 111..131 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 139..159 | CDD:275368 | 7/50 (14%) | ||
C2H2 Zn finger | 167..187 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 195..216 | CDD:275368 | 4/20 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..321 | 14/71 (20%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |