DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and vezf1b

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001073432.1 Gene:vezf1b / 556915 ZFINID:ZDB-GENE-060825-121 Length:460 Species:Danio rerio


Alignment Length:446 Identity:87/446 - (19%)
Similarity:138/446 - (30%) Gaps:160/446 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PIEVAVPQQEKPHL-VPTVSAPPAPLSKPASERVIRENQVRLRRYIKDEMKYDLATG-------- 215
            |:..:.||.:||.| :|....||          :|..:      .:||.|......|        
Zfish    30 PLLNSEPQDQKPVLPIPLDQKPP----------IISSD------LLKDNMGGGTGGGGGGGGGGP 78

  Fly   216 IESSRKNAAKGPNECTMCDRKFVHASGLVRHMEKH-ALDLI--PSQTSEQPHTIPAAGLHVVVKC 277
            :...::..:|.|..|:.|.:.|..:..|.||...| .:.::  |.:|:..|..:|.  :..|.:.
Zfish    79 VVIKKEPKSKTPFICSYCSKAFRDSYHLRRHESCHTGIKMVSRPKKTTTAPTMVPL--ISTVPRD 141

  Fly   278 NSCGRIFYDPQVAFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQN 342
            |: |...|...||   |::          :..|...|..|....:|...:..:...|        
Zfish   142 NN-GNPSYVSTVA---GIL----------TTATTSASTAAGIMSVLPQQQPTVPKKP-------- 184

  Fly   343 TNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHF 407
            ..|.||..          .||.|...|.|:..|..|..||..|:.|||.                
Zfish   185 PKPVKKNH----------GCEMCGKAFRDVYHLNRHKLSHSDEKPFECP---------------- 223

  Fly   408 QTDCIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFC 472
                                     :|..:|...|.:..|                         
Zfish   224 -------------------------ICHQRFKRKDRMTYH------------------------- 238

  Fly   473 DVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLR-FHQGV 536
                                       .|:...|..:.|:|.:|||.:::..||..|:: .|...
Zfish   239 ---------------------------VRSHDGGVHKPYICSVCGKGFSRPDHLSCHVKHVHSTE 276

  Fly   537 KPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIH 592
            :||.||...|...|..:..|..|:.: |.|:  ..|.:||| .|:.:....|...|
Zfish   277 RPFKCQVTACTSAFATKDRLRSHMIR-HEGK--VTCNICGK-MLSAAYITSHLKTH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..453 CDD:275368 4/21 (19%)
COG5048 <450..647 CDD:227381 28/144 (19%)
C2H2 Zn finger 469..490 CDD:275368 0/20 (0%)
zf-C2H2 511..533 CDD:278523 8/22 (36%)
C2H2 Zn finger 513..564 CDD:275368 16/51 (31%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 8/25 (32%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 2/8 (25%)
zf-C2H2 598..620 CDD:278523
C2H2 Zn finger 600..620 CDD:275368
zf-H2C2_2 612..637 CDD:290200
C2H2 Zn finger 628..646 CDD:275368
vezf1bNP_001073432.1 C2H2 Zn finger 93..113 CDD:275368 6/19 (32%)
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
zf-H2C2_2 206..231 CDD:290200 10/65 (15%)
C2H2 Zn finger 222..242 CDD:275368 6/112 (5%)
C2H2 Zn finger 252..270 CDD:275368 7/17 (41%)
C2H2 Zn finger 281..303 CDD:275368 6/22 (27%)
C2H2 Zn finger 309..328 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.