DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ZNF331

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001073375.1 Gene:ZNF331 / 55422 HGNCID:15489 Length:463 Species:Homo sapiens


Alignment Length:571 Identity:131/571 - (22%)
Similarity:201/571 - (35%) Gaps:197/571 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DFLAGVTSSKMTTEQSV--FHGSRSNSS--ASTVNRIKCPTCLVQFDAVAFQNHSCEAKPIEVAV 165
            |..:...:..:.||:::  ...|:.||.  :.::.|                |..||.   .:..
Human    46 DLESAYENKSLPTEKNIHEIRASKRNSDRRSKSLGR----------------NWICEG---TLER 91

  Fly   166 PQQEKPH-----LVPTVSAPPAPLSKP--ASERVIRENQVRLRRYIKDEMK-----YDLATGIES 218
            ||:.:..     ::..|..|......|  ..:|..:||...    .||..|     |.|:   :.
Human    92 PQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFE----CKDCGKAFSRGYQLS---QH 149

  Fly   219 SRKNAAKGPNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRI 283
            .:.:..:.|.||..|.:.|...:.|.:|.:.|        |.|:|:           :|..||: 
Human   150 QKIHTGEKPYECKECKKAFRWGNQLTQHQKIH--------TGEKPY-----------ECKDCGK- 194

  Fly   284 FYDPQVAFRHG---LIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNP 345
                  |||.|   :||...|:       .:.|....|..:....|:.|        |.:|..:.
Human   195 ------AFRWGSSLVIHKRIHT-------GEKPYECKDCGKAFRRGDEL--------TQHQRFHT 238

  Fly   346 PKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHFQTD 410
            .:|:          .:|:.|...|:.:.:|:.|...|..|:.:||..|                 
Human   239 GEKD----------YECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDC----------------- 276

  Fly   411 CIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFCDVN 475
                           .:.|:|        .:.|:|..|                           
Human   277 ---------------GKAFIC--------GSSLIQHKR--------------------------- 291

  Fly   476 FEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFV 540
                    .|:.||                    .|.|..|||::|:.::|.||.:.|.|.||..
Human   292 --------IHTGEK--------------------PYECQECGKAFTRVNYLTQHQKIHTGEKPHE 328

  Fly   541 CQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGK 605
            |:|  |.:.|.....|..| .:.||||:||.|..|||.|..|....||..||.||..|:|:||||
Human   329 CKE--CGKAFRWGSSLVKH-ERIHTGEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGK 390

  Fly   606 RFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANS 656
            .|....:|..|:|||||.|||.|..|.|:|.......:|   :.:|..|.|
Human   391 AFIYGSSLVKHERIHTGVKPYGCTECGKSFSHGHQLTQH---QKTHSGAKS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 7/22 (32%)
C2H2 Zn finger 431..453 CDD:275368 4/21 (19%)
COG5048 <450..647 CDD:227381 62/196 (32%)
C2H2 Zn finger 469..490 CDD:275368 2/20 (10%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 18/50 (36%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 13/25 (52%)
C2H2 Zn finger 572..592 CDD:275368 8/19 (42%)
zf-H2C2_2 585..609 CDD:290200 13/23 (57%)
zf-C2H2 598..620 CDD:278523 10/21 (48%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 14/24 (58%)
C2H2 Zn finger 628..646 CDD:275368 5/17 (29%)
ZNF331NP_001073375.1 KRAB 5..46 CDD:366587 131/571 (23%)
COG5048 <32..284 CDD:227381 63/354 (18%)
C2H2 Zn finger 133..153 CDD:275368 5/22 (23%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
COG5048 185..441 CDD:227381 98/398 (25%)
C2H2 Zn finger 189..209 CDD:275368 9/26 (35%)
C2H2 Zn finger 217..237 CDD:275368 5/27 (19%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
C2H2 Zn finger 273..293 CDD:275368 7/94 (7%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
C2H2 Zn finger 329..349 CDD:275368 6/22 (27%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..405 CDD:275368 9/19 (47%)
C2H2 Zn finger 413..433 CDD:275368 5/22 (23%)
C2H2 Zn finger 441..461 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.