DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG14710

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:432 Identity:94/432 - (21%)
Similarity:161/432 - (37%) Gaps:115/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 AGLHVVVKCNSCGRIFYDPQVAFRHGLIHDSE---------HSTMRQSPMTQVPSNRA------- 317
            |.|.|:::|..|...|.:.|:....|...:|:         ...:||||  |:|....       
  Fly     2 ASLPVILQCRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSP--QLPEKACNSCCEFV 64

  Fly   318 ----DFNELLLDGEMLIDNDPA-------------------------FATSNQNTNPPKKEMFSS 353
                :|.::.|:.::..:...:                         ..|.||     :||..::
  Fly    65 QMWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQ-----EKEEITA 124

  Fly   354 LILGSVLQ-------CEFCEYIFADIAE-------------LLVHSASHVAERRFECTACDIQMN 398
            :..|...|       .:|..:|..:..|             |:.|..|:|.:::.|....|    
  Fly   125 IEEGDEQQEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDD---- 185

  Fly   399 TAKEASIHFQTDCIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGK 463
                           ..|.:..|:...:.|      |:::.:.:||.....:....|....:...
  Fly   186 ---------------KGELVEELSNANTFY------EVEYGDEELLMSSAPSPHPSFKMDKQKPG 229

  Fly   464 KLLLPCDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQ 528
            :...|    |...:|        :.|.:|.|:|..:.:   .....:::|.:||..:.:.|....
  Fly   230 RPRKP----DAELKF--------KRKDINAKERGNQPK---CKEEEKFMCILCGNVFYKKSVFTA 279

  Fly   529 HLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHR 593
            |:..|...||..|  |.|::.|....:|..|||: |||:|||.|:.|.:.|...|...:|..:|.
  Fly   280 HMMTHSEYKPHQC--EICNKSFRQMGELRAHIRR-HTGDRPYKCMYCDRHFYDRSERVRHERVHT 341

  Fly   594 GERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTF 635
            ..|.|.|:||||.|.....||||...|:.:|.|:|..|.|:|
  Fly   342 NTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..453 CDD:275368 3/21 (14%)
COG5048 <450..647 CDD:227381 55/186 (30%)
C2H2 Zn finger 469..490 CDD:275368 2/20 (10%)
zf-C2H2 511..533 CDD:278523 5/21 (24%)
C2H2 Zn finger 513..564 CDD:275368 16/50 (32%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 13/25 (52%)
C2H2 Zn finger 572..592 CDD:275368 5/19 (26%)
zf-H2C2_2 585..609 CDD:290200 10/23 (43%)
zf-C2H2 598..620 CDD:278523 11/21 (52%)
C2H2 Zn finger 600..620 CDD:275368 10/19 (53%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 4/8 (50%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 14/75 (19%)
COG5048 <261..395 CDD:227381 47/126 (37%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 8/24 (33%)
C2H2 Zn finger 292..312 CDD:275368 8/22 (36%)
zf-H2C2_2 304..327 CDD:290200 12/23 (52%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 10/21 (48%)
C2H2 Zn finger 348..368 CDD:275368 10/19 (53%)
C2H2 Zn finger 376..395 CDD:275368 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.