DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG6254

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:511 Identity:116/511 - (22%)
Similarity:188/511 - (36%) Gaps:116/511 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LIHDSEHSTMRQSPMTQVPS---------NRADF--------NELLLDG--EMLIDNDPAFATSN 340
            ::..:|.|:..:|.:..:|:         .:.||        .|:.:.|  |.:::.|.....:.
  Fly   150 IVCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGVEEEILEEDVEEDLAE 214

  Fly   341 QNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRF--------ECTACDIQM 397
            :.....::|:.:   :|..::....|....|..:.||....|:.|.|:        |....|..|
  Fly   215 EEVETVEEEIDT---VGEEVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNM 276

  Fly   398 NTAKEASIHFQTDCIFMREAIRSLNVT------LSRYFV---------------CNVCELKFANT 441
            .|.:....:.|.:.:..::.:.|:...      :||..|               ||:|:..:...
  Fly   277 ETYEIVQHNPQKEPVETKDTVESIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKP 341

  Fly   442 DLLQEH----RCTSFHYFPRLNENGKKLLLP----------------------CDFCDVNFEFAH 480
            ...:.|    ..|.....|:|..|..||..|                      |..|:..|..:.
  Fly   342 KAYKRHMEEVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSG 406

  Fly   481 DFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEEN 545
            ....|.|..|               .:|:.|:||:||||:...:.|..|...|....||.|..  
  Fly   407 TLKRHIEGIH---------------NQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPV-- 454

  Fly   546 CDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRA 610
            |.|.|.....|..|: ..|:.| .|.|.|||.:..|...|.:|:|:|...|:::||.||..|.|:
  Fly   455 CKRGFKNNARLKIHL-DTHSAE-IYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRS 517

  Fly   611 DALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDA--------NSRLMMQMQKFQ- 666
            ..||.|..:|||.:||.|.||.:.|....:...|.|..|....|        .|.|:..:.:.. 
  Fly   518 KTLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELAEEEARGVTRSTLLPMLDELTI 582

  Fly   667 ----LETAAAQ-KAQSHNPE--QQDNDVAGGASTSDVPSGSGFMSTEPSVAEMQYS 715
                |:|.|.. |.:...|:  .:|.|....:.|.|.   .|.:..| .|.|:.||
  Fly   583 ASKLLKTPAGPCKVKGSRPKAAPKDQDNGNESPTKDT---DGAILYE-LVEELDYS 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 0/1 (0%)
C2H2 Zn finger 431..453 CDD:275368 5/25 (20%)
COG5048 <450..647 CDD:227381 64/218 (29%)
C2H2 Zn finger 469..490 CDD:275368 5/20 (25%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 17/50 (34%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 9/25 (36%)
C2H2 Zn finger 572..592 CDD:275368 8/19 (42%)
zf-H2C2_2 585..609 CDD:290200 10/23 (43%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 12/24 (50%)
C2H2 Zn finger 628..646 CDD:275368 5/17 (29%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 64/219 (29%)
C2H2 Zn finger 364..384 CDD:275368 4/19 (21%)
C2H2 Zn finger 395..416 CDD:275368 5/20 (25%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 452..472 CDD:275368 6/22 (27%)
C2H2 Zn finger 479..499 CDD:275368 8/19 (42%)
C2H2 Zn finger 507..527 CDD:275368 9/19 (47%)
zf-H2C2_2 520..544 CDD:290200 12/23 (52%)
C2H2 Zn finger 535..553 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.