Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649316.1 | Gene: | Neu2 / 40375 | FlyBaseID: | FBgn0037085 | Length: | 382 | Species: | Drosophila melanogaster |
Alignment Length: | 270 | Identity: | 70/270 - (25%) |
---|---|---|---|
Similarity: | 99/270 - (36%) | Gaps: | 68/270 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 469 CDFCDVNFEFAHDFLAHSEEKH----LNKKKREKETRNTGAGRIRQ------------------- 510
Fly 511 ----------------YLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDH 559
Fly 560 IRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEK 624
Fly 625 PYSCLFCTKTFRQRGDRDKHIR----------------ARHS----HLDANSRLMMQMQKFQLET 669
Fly 670 AAAQKAQSHN 679 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
C2H2 Zn finger | 277..297 | CDD:275368 | |||
C2H2 Zn finger | 431..453 | CDD:275368 | |||
COG5048 | <450..647 | CDD:227381 | 59/232 (25%) | ||
C2H2 Zn finger | 469..490 | CDD:275368 | 5/20 (25%) | ||
zf-C2H2 | 511..533 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 513..564 | CDD:275368 | 18/50 (36%) | ||
C2H2 Zn finger | 541..561 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 555..581 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 572..592 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 585..609 | CDD:290200 | 6/23 (26%) | ||
zf-C2H2 | 598..620 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 600..620 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 612..637 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 628..646 | CDD:275368 | 5/17 (29%) | ||
Neu2 | NP_649316.1 | zf-AD | 1..63 | CDD:285071 | 6/24 (25%) |
COG5048 | <119..241 | CDD:227381 | 43/124 (35%) | ||
C2H2 Zn finger | 121..141 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 133..158 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 6/22 (27%) | ||
zf-H2C2_2 | 162..185 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 206..286 | CDD:292531 | 21/85 (25%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 260..297 | CDD:275368 | 10/42 (24%) | ||
C2H2 Zn finger | 303..323 | CDD:275368 | |||
C2H2 Zn finger | 353..373 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45446590 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |