DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG17359

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:390 Identity:99/390 - (25%)
Similarity:148/390 - (37%) Gaps:110/390 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 DFNELLLDGEMLIDNDPAFATSN--QNTNPPKKEMFSSLILGSVL-QCEFCEYIFADIAELLVHS 379
            |.::.|||    |..:| :|:||  |...|         :|.::| :|..|.          ||.
  Fly    12 DESDCLLD----IYTEP-YASSNRVQEQEP---------VLATMLRECSGCS----------VHK 52

  Fly   380 ASHVAERRFECTACDIQMNTA-------KEASIHFQTDCIFMRE---AIRSLNV--TLSRYFVCN 432
            ...:.:  |.|..|...:..|       :::..:|:...:.|:|   ....||:  .:......:
  Fly    53 EDGMPQ--FICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVS 115

  Fly   433 VCEL-KFANT------DLLQ-------------------EHRCTSFHYFPRLNENGKKLLLPCDF 471
            |.|. |...|      :|:|                   ||:... .|.|....:.|.......:
  Fly   116 VMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQ-SYSPAKTPHNKSKRRARSY 179

  Fly   472 CDVNFEFAHDF-LAH-SEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQ 534
            .| |..::.|. |.| .::|..|..||.|..|..|     .|.|.:|.:|:||..:|..|:|.|.
  Fly   180 SD-NDSWSPDSELEHEDDDKIWNASKRGKPKRVPG-----PYRCKLCTQSFTQKQNLEIHMRIHT 238

  Fly   535 GVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYE 599
            |.:|:.|  ..|.|.|..:.:|..|.| |||||||                            :.
  Fly   239 GERPYKC--SLCPRSFAQKGNLQSHTR-CHTGERP----------------------------FG 272

  Fly   600 CEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQK 664
            |..|.|||.:...|:.|.|.||||:|:.|..|.::|:|.....||:.|   |.....|...|..|
  Fly   273 CPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSA---HTRGKRRTSSQETK 334

  Fly   665  664
              Fly   335  334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 8/47 (17%)
COG5048 <450..647 CDD:227381 60/198 (30%)
C2H2 Zn finger 469..490 CDD:275368 5/22 (23%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 18/50 (36%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 10/25 (40%)
C2H2 Zn finger 572..592 CDD:275368 0/19 (0%)
zf-H2C2_2 585..609 CDD:290200 5/23 (22%)
zf-C2H2 598..620 CDD:278523 8/21 (38%)
C2H2 Zn finger 600..620 CDD:275368 8/19 (42%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 22/101 (22%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 10/26 (38%)
C2H2 Zn finger 245..265 CDD:275368 7/22 (32%)
zf-H2C2_2 257..282 CDD:290200 15/53 (28%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.