DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and snai2

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_989424.1 Gene:snai2 / 395065 XenbaseID:XB-GENE-487371 Length:266 Species:Xenopus tropicalis


Alignment Length:161 Identity:49/161 - (30%)
Similarity:74/161 - (45%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 EEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFH---QGVKPFVCQEENCDR 548
            ||:.|..|..:..     |....::.|.:|.|:|:..|.|.:|.:.|   |..|.|.|  :.|::
 Frog   107 EEERLQTKLSDSH-----AIEAEKFQCSLCSKTYSTFSGLAKHKQLHCDAQSRKSFSC--KYCEK 164

  Fly   549 KFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADAL 613
            ::.....|..||| .||  .|.:|.:|||.|....:...|...|.||:.:.|..|.:.|.....|
 Frog   165 EYVSLGALKMHIR-THT--LPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNL 226

  Fly   614 KNHQRIHTGEKPYSCLFCTKTFRQRGDRDKH 644
            :.|.:.|:..|.|.|..|:|||.:.....||
 Frog   227 RAHLQTHSDVKKYQCKNCSKTFSRMSLLHKH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 49/161 (30%)
C2H2 Zn finger 469..490 CDD:275368 2/2 (100%)
zf-C2H2 511..533 CDD:278523 7/21 (33%)
C2H2 Zn finger 513..564 CDD:275368 17/53 (32%)
C2H2 Zn finger 541..561 CDD:275368 4/19 (21%)
zf-H2C2_2 555..581 CDD:290200 12/25 (48%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 7/23 (30%)
zf-C2H2 598..620 CDD:278523 5/21 (24%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 612..637 CDD:290200 10/24 (42%)
C2H2 Zn finger 628..646 CDD:275368 7/17 (41%)
snai2NP_989424.1 DUF4764 82..>160 CDD:292583 17/59 (29%)
C2H2 Zn finger 128..148 CDD:275370 7/19 (37%)
C2H2 Zn finger 159..179 CDD:275368 6/22 (27%)
C2H2 Zn finger 185..205 CDD:275368 6/19 (32%)
zf-H2C2_2 198..221 CDD:290200 6/22 (27%)
zf-C2H2 211..233 CDD:278523 5/21 (24%)
C2H2 Zn finger 213..233 CDD:275368 5/19 (26%)
zf-H2C2_2 225..250 CDD:290200 10/24 (42%)
C2H2 Zn finger 241..257 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.