DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and D19B

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster


Alignment Length:569 Identity:131/569 - (23%)
Similarity:195/569 - (34%) Gaps:123/569 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNP---PKKEMFSSLIL 356
            |...|.....|.|.....|.:.|...|     |...:::...::.:.:.||   ||::...:...
  Fly   188 LAQRSRRGATRGSKAKGKPKSAAKRQE-----EESEESEETSSSDDSDGNPKDKPKRKRIPATER 247

  Fly   357 G--SVLQCEFCEYIFADIAELLVHSASHVAERRFECT--ACDIQMNTAKEASIHFQTDCIFMREA 417
            .  .::.|..|...|........|...|.....|:||  :|.....||....:|           
  Fly   248 DRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVH----------- 301

  Fly   418 IRSLNVTLSRYFVCNV--CELKFANTDLLQEHRCTSFHYFPRLNE-NGKKLLLPCDFCDVNFEFA 479
            :...:...|....|..  |...||...||      ||| ..|::: :..:...||..|:..|.  
  Fly   302 VEHAHTETSAMHPCTYEGCNKSFARPVLL------SFH-MKRVHKVDTPQRDFPCTECEKVFR-- 357

  Fly   480 HDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEE 544
               ...:.:||:.|.          .|....:.|:||||.:..:|.|..||..|.|:|..||  .
  Fly   358 ---CPTALKKHMYKH----------TGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVC--P 407

  Fly   545 NCDRKFTIRPDLNDHIRKCHTGERPYLCLVC-----GKRFLTGSVFYQHRLIHRGERRYECEECG 604
            .|....|.|.:.|.|| ..||.|:.|.|..|     .|:.|...|    :::|...:.:.|:.||
  Fly   408 YCGVGKTTRQEWNKHI-LTHTKEKKYECRQCDHASHNKQALANHV----KVVHEKRKDFACQYCG 467

  Fly   605 KRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLET 669
            |.|.::.|.|.|:|.|||||...|..|.|.|.......||::. |...|        :.|.|...
  Fly   468 KTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKT-HEKRD--------LPKTQGTN 523

  Fly   670 A----------AAQKAQSH---NPEQQDNDVAGGASTSDVPS----------------------- 698
            |          ...|...|   ..|:.|.....|...:.:||                       
  Fly   524 ALMGDGASGSSTIAKPSPHLRGRVERVDIAQLAGTVANPIPSVNLPSWSPQVNFTKKEGQHICPD 588

  Fly   699 -GSGFMSTEPSVAEMQYSITPEQQEEMVC--VPIDEVNNSFFMSH-YMQA--VPMEEDGSGQHII 757
             |.||  ...|..::.|.:..::.::..|  .|.......:...| |:..  .|.|....|:|  
  Fly   589 CGKGF--NHVSNMKLHYKVVHQKVKDFCCRFCPKRFAKKQYLRHHEYIHTGEKPYECKVCGKH-- 649

  Fly   758 VFEQPGQNMDMMSIYDQQQVGEPMHESGVPKRPAEENAR--VVVVKNNP 804
             |.|.......|.::|     :|....|.||.||...|.  ..|.:..|
  Fly   650 -FRQEQVLKTHMKVHD-----KPPRPPGKPKEPAGPKAESSTAVKRQQP 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 1/1 (100%)
C2H2 Zn finger 431..453 CDD:275368 7/23 (30%)
COG5048 <450..647 CDD:227381 62/202 (31%)
C2H2 Zn finger 469..490 CDD:275368 3/20 (15%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 20/50 (40%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 10/30 (33%)
C2H2 Zn finger 572..592 CDD:275368 5/24 (21%)
zf-H2C2_2 585..609 CDD:290200 6/23 (26%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 13/24 (54%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 16/69 (23%)
C2H2 Zn finger 318..338 CDD:275368 9/26 (35%)
COG5048 <347..512 CDD:227381 58/187 (31%)
C2H2 Zn finger 349..369 CDD:275368 5/24 (21%)
C2H2 Zn finger 378..398 CDD:275368 9/19 (47%)
C2H2 Zn finger 406..426 CDD:275368 7/22 (32%)
C2H2 Zn finger 434..455 CDD:275368 5/24 (21%)
C2H2 Zn finger 463..483 CDD:275368 9/19 (47%)
C2H2 Zn finger 491..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 586..607 CDD:275368 5/22 (23%)
C2H2 Zn finger 615..635 CDD:275368 4/19 (21%)
zf-H2C2_2 627..652 CDD:290200 7/27 (26%)
C2H2 Zn finger 643..663 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.