DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and Oaz

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster


Alignment Length:969 Identity:170/969 - (17%)
Similarity:269/969 - (27%) Gaps:393/969 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELDQQLTPDDLQPGATVLATNESTGGLERIVSHEELSRFFAVGPAGALPMPTDVVVERTLADPA- 80
            |..||..|...:|.|......|.    |.....|||..            |.|.||....|..| 
  Fly    72 ESQQQSWPTADEPAAPAAVAKEE----EAEEGSEELQH------------PRDEVVASDAAANAN 120

  Fly    81 --FKQILQEADGKKGFDPQAEQMKIRDFLAGVTSSK---------MTTEQSVFHGSRSNSSAS-- 132
              .|....|.|.....:|  |.:::.|.|..::..:         :.:..|..:.:.::||.|  
  Fly   121 GHCKSSGHEEDAVDAEEP--EDLELDDELLSLSGDEDYDDEELQSLDSFYSDMYSTHTSSSYSPS 183

  Fly   133 ------TVNR---IKCPTCLVQFDAVAFQNHSCEAK----------PIEVAVPQQEKPHLVPTVS 178
                  |.|.   |..||      |...::|..|.|          |....:|.....|      
  Fly   184 ISDGTMTPNSHHLIGAPT------AAGQEDHPTEGKINGGADGEDLPKPKRLPHFHHHH------ 236

  Fly   179 APPAPLSKPASERVIRENQV-----RLRRYIKD--------------EMKYDLATGIESSRKNAA 224
                       .......|.     :||:..|:              ..|:|..||  ...|:..
  Fly   237 -----------HHHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFDKLTG--EGIKSRG 288

  Fly   225 KGPNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRIFYDPQV 289
            .|..:|..|::.|.....|..|::.||                   .|:..||..|.::|...:.
  Fly   289 DGSYQCQFCEKTFPRLGYLKHHVQSHA-------------------EHLPFKCEYCSKLFKHKRS 334

  Fly   290 AFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNPPKKEMFSSL 354
            ..||..:|.:|.:                                                    
  Fly   335 RDRHKKLHTNERN---------------------------------------------------- 347

  Fly   355 ILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHFQ----------- 408
                 .:|..||..|:....|.:|..:|..::.|:|:.|:...|||...:.|.|           
  Fly   348 -----YKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKHKKNAAILAA 407

  Fly   409 ----TDCIFMREAIRSLNVTLS--------RYFV------------------------------- 430
                ....:...:..|.:.::|        ||.:                               
  Fly   408 GGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRMDFPKRSRSNHVGGTTTTATP 472

  Fly   431 -----CNVCE--LKFANTDLLQEHRCTSFHYFPRLN------ENGKKLLLPCDFCDVNFE----- 477
                 |:.|.  .:|::.:.|..| ..|.|..|:..      :.|:...|.|::|.:.|.     
  Fly   473 TPLLRCSYCPKVTEFSSLEQLNAH-LQSVHEQPQTQAVKTPVQEGEGFQLSCEYCTMKFGNIAGL 536

  Fly   478 FAHDFLAHSEE--------KHLNK----------------------KKREKETR----------- 501
            |.|....|.:.        :|.|:                      ...|:|:|           
  Fly   537 FQHMRSTHMDRLSSPNSYYEHFNRLATAGTFSPRLALDLPKIKPDLGSPERESRPAEDDLPTDLS 601

  Fly   502 --------------------------------NTGAGRIR--------------QYLCDICGKSY 520
                                            |.|.....              |.:|..||.|.
  Fly   602 NNKRRPLTPNPQAQTPLAPPSAPPGVFFCNQCNAGLPDFESFRNHLKSHIAEGMQLVCPHCGMSL 666

  Fly   521 TQSSHLWQHLRFHQGV--KPFVCQEENCDRKFTIRPDLNDH--------IRKC------------ 563
            .:.|...:|:..|..:  ..|.| ..:|.:.|....||..|        :.||            
  Fly   667 PEQSEFERHVVGHFLITGSEFNC-SSSCGKSFAKSEDLQQHLLSEHVLTLLKCSLCSELCESRMA 730

  Fly   564 --------HTGERPYL-CLVCGKRFLTGSVFYQH-RLIHR-------------GERRYECEECGK 605
                    |:.|...| |..|.:.|.:.:.|:.| :..|:             .....:|..|  
  Fly   731 MQLHLACAHSQETKLLRCSACLELFRSDAEFHVHVKTRHQLGGHPTLGATSSAPTNPLQCMFC-- 793

  Fly   606 RFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHL---DANSRLMMQMQKFQL 667
            |...:..|:.|..:....:.:.|..|.:||......|:|::::|..:   :|||..|..:....|
  Fly   794 RAVCSSELEMHFHLAAHARQFRCPSCPETFHVEFLLDRHMQSQHGGVKDKEANSPNMGSLYVNAL 858

  Fly   668 -----ETAAAQKAQSHNPEQQDNDVA-----GGASTSDVPSGSGFMS-TEPSVAEMQYS 715
                 ..|||..|.::|....|.:||     ||||......|.|..| ..|..|...||
  Fly   859 LPPLAAAAAAAAATNNNSSIIDYNVAFKGLFGGASGGAGSGGGGAQSGGAPPSANKFYS 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..453 CDD:275368 6/23 (26%)
COG5048 <450..647 CDD:227381 55/339 (16%)
C2H2 Zn finger 469..490 CDD:275368 6/33 (18%)
zf-C2H2 511..533 CDD:278523 6/21 (29%)
C2H2 Zn finger 513..564 CDD:275368 16/80 (20%)
C2H2 Zn finger 541..561 CDD:275368 6/27 (22%)
zf-H2C2_2 555..581 CDD:290200 11/54 (20%)
C2H2 Zn finger 572..592 CDD:275368 5/20 (25%)
zf-H2C2_2 585..609 CDD:290200 6/37 (16%)
zf-C2H2 598..620 CDD:278523 5/21 (24%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 612..637 CDD:290200 6/24 (25%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 5/19 (26%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
zf-H2C2_2 334..359 CDD:290200 8/81 (10%)
COG5048 336..769 CDD:227381 71/491 (14%)
zf-C2H2 348..370 CDD:278523 6/21 (29%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 630..650 CDD:275368 2/19 (11%)
C2H2 Zn finger 659..679 CDD:275368 6/19 (32%)
C2H2 Zn finger 689..707 CDD:275368 5/18 (28%)
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.