| Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
| Alignment Length: | 262 | Identity: | 74/262 - (28%) |
|---|---|---|---|
| Similarity: | 106/262 - (40%) | Gaps: | 65/262 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 469 CDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFH 533
Fly 534 QGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRY 598
Fly 599 ECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQ 663
Fly 664 KFQLETAAAQKAQSHNPEQQDNDVAGGASTSDVPSGSGFMSTEPSVAEMQYSITPEQQ----EEM 724
Fly 725 VC 726 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
| C2H2 Zn finger | 277..297 | CDD:275368 | |||
| C2H2 Zn finger | 431..453 | CDD:275368 | |||
| COG5048 | <450..647 | CDD:227381 | 58/177 (33%) | ||
| C2H2 Zn finger | 469..490 | CDD:275368 | 7/20 (35%) | ||
| zf-C2H2 | 511..533 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 513..564 | CDD:275368 | 17/50 (34%) | ||
| C2H2 Zn finger | 541..561 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 555..581 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 585..609 | CDD:290200 | 8/23 (35%) | ||
| zf-C2H2 | 598..620 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 600..620 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 612..637 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 628..646 | CDD:275368 | 6/17 (35%) | ||
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 60/209 (29%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 5/22 (23%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 7/49 (14%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446656 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||