| Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102375.1 | Gene: | Zfp524 / 365179 | RGDID: | 1565485 | Length: | 314 | Species: | Rattus norvegicus |
| Alignment Length: | 242 | Identity: | 59/242 - (24%) |
|---|---|---|---|
| Similarity: | 87/242 - (35%) | Gaps: | 74/242 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 504 GAGRIR-QYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGE 567
Fly 568 RPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCT 632
Fly 633 KTFRQRGDRDKHIRARHSHL------------------DANSRLMMQ--MQKFQLE--------- 668
Fly 669 --------TAAAQKAQSHNPEQQDNDVAGGASTSDVPSGSGFMSTEP 707 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
| C2H2 Zn finger | 277..297 | CDD:275368 | |||
| C2H2 Zn finger | 431..453 | CDD:275368 | |||
| COG5048 | <450..647 | CDD:227381 | 41/143 (29%) | ||
| C2H2 Zn finger | 469..490 | CDD:275368 | |||
| zf-C2H2 | 511..533 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 513..564 | CDD:275368 | 10/50 (20%) | ||
| C2H2 Zn finger | 541..561 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 555..581 | CDD:290200 | 4/25 (16%) | ||
| C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 585..609 | CDD:290200 | 9/23 (39%) | ||
| zf-C2H2 | 598..620 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 600..620 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 612..637 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 628..646 | CDD:275368 | 4/17 (24%) | ||
| Zfp524 | NP_001102375.1 | COG5048 | <102..218 | CDD:227381 | 41/146 (28%) |
| C2H2 Zn finger | 111..131 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 123..148 | CDD:290200 | 11/55 (20%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 7/50 (14%) | ||
| zf-H2C2_2 | 151..174 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 179..203 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 195..216 | CDD:275368 | 4/20 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||