DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG12391

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster


Alignment Length:709 Identity:149/709 - (21%)
Similarity:240/709 - (33%) Gaps:227/709 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LQEADGKKGFDPQ-----AEQMKIRDFLAGVTSSKMTTEQSVFHGSRSNSSASTVNRIKCPTCLV 144
            |.|.:|::..:||     .||.:.|..|||         :||  ||..:..:.||.:|   ...:
  Fly     8 LAETNGEQRQNPQESAQNQEQPQPRQDLAG---------KSV--GSADDGVSGTVGQI---MDYL 58

  Fly   145 QFDAVAFQNHSC---EAKPIEVAVPQQEKPHLVPTVSAPPAPLSKPASERVIRENQVRLRRYIKD 206
            :.||.|..:...   ||:.::..:||:::..         .|.::.|:|.....:.       |.
  Fly    59 EDDAGATADQDAEMGEAEYLDGEMPQEDESE---------TPQTEKANEGCQESSN-------KK 107

  Fly   207 EMKYDLATGIESSRKNAAKGPNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGL 271
            :::...|....|..|:...|..:   .|:            ||.|..|......:          
  Fly   108 DLQESAAKDDFSKEKSGEDGEKD---TDK------------EKKATHLHEDNNDD---------- 147

  Fly   272 HVVVKCNSCGRIFYDPQVAFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDND--- 333
                              |.:.|...|:|.....:.|..:..:...|  |.:.:.|..:|.|   
  Fly   148 ------------------AEKDGDEADAEDEDDVEKPEDEDGTEEGD--EAIEEDEDALDEDEDP 192

  Fly   334 --------PAFATSNQNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFE- 389
                    |.|.|..        :....||.|...         .|:|::      .:.||:.| 
  Fly   193 NEEVEEIEPDFETGT--------DAEGELITGDEP---------GDLADV------PIRERKKEE 234

  Fly   390 ------CTACDIQMNTAKEASIHFQTDCIFMRE---------AIRSLNVTL-----SRYFVCNVC 434
                  |..|     |:||..:     |:|.::         .:...||::     ...|:|..|
  Fly   235 PVDEDQCRVC-----TSKEELV-----CLFKKQIDATPADMLLVICPNVSILPKDFMPQFICTKC 289

  Fly   435 --ELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFC--------------DVNFEF----- 478
              .|..| ..|.::...|......||:.:..|:..|..:.              :::.||     
  Fly   290 MGSLTIA-IQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDV 353

  Fly   479 -----AHDFLAHSEEKHLNKKK-------REKE----TRNTGAGRIRQYLCDICGKSYTQSSHLW 527
                 |....|.|::....|||       |:|.    |.:.|.....|      .|.|..||   
  Fly   354 AGTTSADSDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGEPSSAQ------KKKYQPSS--- 409

  Fly   528 QHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGER-PYLCLVCGKRFLTGSVFYQHRLI 591
                 ...|.||.|  .|||..|:.:.....| ||.|  || .:.|.:|||:|.....:..|...
  Fly   410 -----TASVGPFEC--PNCDLTFSRKQSYVLH-RKTH--ERIEHACPICGKKFKVEWAYKTHMQR 464

  Fly   592 HRGER-RYECEECGKRFYRADALKNH--QRIHTGEKPYSCLFCTKTF--RQRGDRDKHIRARHSH 651
            |..|| .:.||.|.|.|.....||:|  ||.......|.|..|.:||  :||..|.:.:..:. |
  Fly   465 HEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQR-H 528

  Fly   652 LDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAGGASTSDVPSGSG---FMSTEP 707
            .:.:.|:..:..:|:.|:.:  |...|:          |.::|....|.|   |.:..|
  Fly   529 KEDSVRIKEEQSRFKQESRS--KDDRHH----------GNNSSKRRPGEGRDLFKAVAP 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 2/19 (11%)
C2H2 Zn finger 277..297 CDD:275368 2/19 (11%)
C2H2 Zn finger 431..453 CDD:275368 6/23 (26%)
COG5048 <450..647 CDD:227381 63/237 (27%)
C2H2 Zn finger 469..490 CDD:275368 5/44 (11%)
zf-C2H2 511..533 CDD:278523 4/21 (19%)
C2H2 Zn finger 513..564 CDD:275368 15/50 (30%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 11/26 (42%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 9/24 (38%)
zf-C2H2 598..620 CDD:278523 10/23 (43%)
C2H2 Zn finger 600..620 CDD:275368 10/21 (48%)
zf-H2C2_2 612..637 CDD:290200 10/28 (36%)
C2H2 Zn finger 628..646 CDD:275368 7/19 (37%)
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 16/83 (19%)
zf-C2H2 416..438 CDD:278523 9/24 (38%)
C2H2 Zn finger 418..438 CDD:275368 8/22 (36%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 7/16 (44%)
C2H2 Zn finger 504..521 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.