DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG30431

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:193 Identity:61/193 - (31%)
Similarity:91/193 - (47%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 LLPCDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHL 530
            |.||..|:..|........|....|             |.|.:| |.|:.|.|::.....|..|:
  Fly   231 LHPCPECEKKFTRNFQLKLHMTAVH-------------GMGEMR-YQCEECRKNFASRHSLRYHV 281

  Fly   531 R-FHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGE---RPYLCLVCGKRFLTGSVFYQHRLI 591
            : .|...:||.||  :|||:|.:|..|..|:| .||||   |.:.|..|.|.:.|.|....|...
  Fly   282 KSVHSTERPFGCQ--HCDRRFILRTQLLSHLR-THTGEAKPRIFECQRCSKSWPTKSDLRTHMRS 343

  Fly   592 HRG--ERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHL 652
            |..  ||.::|:.|.|.|:....|.:|..:||||||::|.:|.|.::..|:.:.|:...|:.:
  Fly   344 HNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLHADI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 60/186 (32%)
C2H2 Zn finger 469..490 CDD:275368 4/20 (20%)
zf-C2H2 511..533 CDD:278523 6/22 (27%)
C2H2 Zn finger 513..564 CDD:275368 18/51 (35%)
C2H2 Zn finger 541..561 CDD:275368 9/19 (47%)
zf-H2C2_2 555..581 CDD:290200 11/28 (39%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 8/25 (32%)
zf-C2H2 598..620 CDD:278523 6/21 (29%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 5/17 (29%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 4/20 (20%)
C2H2 Zn finger 264..285 CDD:275368 5/20 (25%)
C2H2 Zn finger 293..313 CDD:275368 10/22 (45%)
zf-C2H2_8 305..373 CDD:292531 23/68 (34%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..403 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.