DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and Plzf

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:578 Identity:127/578 - (21%)
Similarity:207/578 - (35%) Gaps:195/578 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 HS-TMRQSPMTQVP-----SN-------RADFNELLLDGEMLIDNDPA---------------FA 337
            || ||:..|....|     ||       ...|.:|||:    :|:|.:               |.
  Fly     3 HSQTMQSIPTLHQPLHSKVSNYLNNQRRTGQFCDLLLE----LDSDDSLSLSVHFCVLAAQSQFI 63

  Fly   338 TSNQNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTAC--------- 393
            .|||     |::.||                        :|:...:..|.|.||.|         
  Fly    64 NSNQ-----KQQQFS------------------------IHNPLKITIRNFSCTQCLHTIVDFFY 99

  Fly   394 -DIQMNTAKEASIHFQTDCIFMREAIRSLNVT--LSRYFVCNVCELKFA---------------- 439
             |: ::.:||..:||       ||..:.|.||  |:.|.:..:.|.|.|                
  Fly   100 EDL-VSVSKEHELHF-------RELAQILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPDPE 156

  Fly   440 -NTDLLQEHRCTSFHYF----PRLNENGKKL--LLPCDFCDVNFEFAHDFLAHSEEKHLNKKKRE 497
             ..:.:.|:|.:   ||    ||..::..|:  .:.|||.....:...:.:...|..||      
  Fly   157 KKAEAVFENRQS---YFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHL------ 212

  Fly   498 KETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQG--VKPFVCQEENCDRKFTIRPDLNDHI 560
                          :|.:|...:........|||.|.|  .|||.|.:  |..:|..|..|..|.
  Fly   213 --------------ICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQ--CGIRFNTRAALLVHQ 261

  Fly   561 RKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKP 625
            .| |:.|.|::|..|||.|........|.|:|..|::..|:.||.......|||:|:.:||||  
  Fly   262 PK-HSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGE-- 323

  Fly   626 YSCLFCTKT-FRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAG 689
              ...||.: .:.|.:|.::::.   |::.:.    |.:.|..|....:.:||.|.::.      
  Fly   324 --FFACTVSGCKHRANRKENLKL---HIETHK----QGRDFICEVCGCKFSQSKNLKRH------ 373

  Fly   690 GASTSDVPSGSGFMSTEPSVAEMQYSITPEQQEEMVCVPIDEVNNSFFMSHYMQAVPMEEDGSGQ 754
                       ....||..         |.:.:..:|         .|.||       ..|...:
  Fly   374 -----------ALKHTENG---------PNRYKCQLC---------GFSSH-------RSDKMKE 402

  Fly   755 HI--IVFEQPGQNMDMMSIYDQQQVGE---PMHESGVPKRPAEENARVVVVKN-NPTK 806
            |:  :..|:|.| :::....|.....:   |:.|:...|:|  ::.:...::| ||.|
  Fly   403 HVQRVHTEKPVQ-LELSETVDSSFPDDFELPVIETSPKKKP--KSVKSKTIRNVNPDK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 5/38 (13%)
COG5048 <450..647 CDD:227381 55/205 (27%)
C2H2 Zn finger 469..490 CDD:275368 4/20 (20%)
zf-C2H2 511..533 CDD:278523 5/21 (24%)
C2H2 Zn finger 513..564 CDD:275368 17/52 (33%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 11/25 (44%)
C2H2 Zn finger 572..592 CDD:275368 7/19 (37%)
zf-H2C2_2 585..609 CDD:290200 7/23 (30%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 10/25 (40%)
C2H2 Zn finger 628..646 CDD:275368 4/18 (22%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 62/285 (22%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/22 (32%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
C2H2 Zn finger 330..349 CDD:275368 3/21 (14%)
C2H2 Zn finger 357..377 CDD:275368 4/36 (11%)
C2H2 Zn finger 387..408 CDD:275368 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.