DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and Kr-h1

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:409 Identity:111/409 - (27%)
Similarity:162/409 - (39%) Gaps:78/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 EMLIDNDPAFATSNQ--NTNPPKKEMFSSLILGSV---------LQCEFCEYIFADIAELLVHSA 380
            |.:.:..|..|.|.|  .|.|......|:.::..|         .:|:.|...|...:....|:.
  Fly   150 ESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTK 214

  Fly   381 SHVAERRFECTACDIQMNTAKEASI--HFQTDCIFMREA-----------IRSL-NVTL-SRYFV 430
            ||...:       |:.:|.|..|.:  ...|..|.:.:|           |:.| ||.. :..:.
  Fly   215 SHSKNQ-------DLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQ 272

  Fly   431 CNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDFLAHSEEKHLNKKK 495
            ||||:..||....|..|..|  |...|..|        |:||       |...:..|...::::.
  Fly   273 CNVCQKTFAVPARLIRHYRT--HTGERPFE--------CEFC-------HKLFSVKENLQVHRRI 320

  Fly   496 REKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHI 560
            ..||         |.|.||:||:::..|..|.:|:|.|.|.:|..|..  |::.|.....|..|:
  Fly   321 HTKE---------RPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSV--CEKTFIQSGQLVIHM 374

  Fly   561 RKCHTGERPYLCLV--CGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGE 623
            | .||||:||.|..  |||.|........|...|.||:.|.|:.|.:.|.....||.|:..|.|.
  Fly   375 R-THTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGS 438

  Fly   624 KPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVA 688
            |.|.|..|.:||:.:.:.:.||:..     ||     ::...:.|.|||..|.|.:.    ...|
  Fly   439 KCYKCTICDETFKNKKEMEAHIKGH-----AN-----EVPDDEAEAAAASAAASTSA----GSSA 489

  Fly   689 GGASTSDVPSGSGFMSTEP 707
            |..|...|.|.|...:..|
  Fly   490 GSPSLQGVSSNSESSNHSP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 9/21 (43%)
COG5048 <450..647 CDD:227381 62/198 (31%)
C2H2 Zn finger 469..490 CDD:275368 5/20 (25%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 17/50 (34%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
zf-H2C2_2 555..581 CDD:290200 14/27 (52%)
C2H2 Zn finger 572..592 CDD:275368 6/21 (29%)
zf-H2C2_2 585..609 CDD:290200 8/23 (35%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 5/17 (29%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 56/178 (31%)
zf-C2H2 271..293 CDD:278523 9/23 (39%)
C2H2 Zn finger 273..293 CDD:275368 9/21 (43%)
zf-H2C2_2 286..309 CDD:290200 10/39 (26%)
C2H2 Zn finger 301..321 CDD:275368 5/26 (19%)
zf-H2C2_2 313..338 CDD:290200 8/33 (24%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 8/23 (35%)
C2H2 Zn finger 357..377 CDD:275368 6/22 (27%)
zf-H2C2_2 370..396 CDD:290200 14/26 (54%)
C2H2 Zn finger 385..407 CDD:275368 6/21 (29%)
zf-H2C2_2 400..424 CDD:290200 8/23 (35%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 7/21 (33%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.