DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG3407

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster


Alignment Length:763 Identity:175/763 - (22%)
Similarity:265/763 - (34%) Gaps:208/763 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GATVLATNESTGGLERIVS-------------HEELSRFFAVGPAGALPMPTDVVVERTLADPAF 81
            |.|.|:||.|:|..|..|.             |..:.:|     ........|||..:..|.|.|
  Fly    34 GPTNLSTNPSSGNSESGVGYVEKESLTPELNFHNTIFQF-----VNKSSPENDVVPHQVDAQPTF 93

  Fly    82 KQILQE----ADGKKGFDPQAEQMKIRDFLAGVTSSKMTTEQSVF-------------------H 123
            ..:..|    .|...|....      .|.|....::..|..:.|.                   |
  Fly    94 PALAIEPTVPIDVSTGLHED------EDLLYAHNNASCTNARKVLPHKKRISRKLKGNIDPELDH 152

  Fly   124 GSRSNSSASTVNRIKCPTC----LVQFDAVAFQNHSCEAKPIE----VAVPQQEKPHLVPTVSAP 180
            ..:.....:..:...|..|    ..|.|..|......|...:|    |..|||:..      ...
  Fly   153 QHKHVQDVAPSSLYSCEICGYAVHTQLDFFAHLKQHYEPTVLEQRLVVQDPQQQHQ------QKE 211

  Fly   181 PAPLSKPASERVIRENQVRLRRYIKD-EMKYDLATGIESSRKNAAK-GPNECTMCDRKFVHASGL 243
            |..:...:::..:::.|.:|.:..:| ::.::....|.....:.|. |.|              :
  Fly   212 PLDMCGLSAQDKLQQEQAKLDQVFQDVQLNFENFHNISHHVNDVANVGVN--------------M 262

  Fly   244 VRH-MEKHALDLIPSQTSEQPHTIPAA-------------GLHVVVKC----NSCGRIFYDPQVA 290
            |.| .....|:.:...||..|:::|..             |:..||..    ::|..:.      
  Fly   263 VLHGQATDKLNAVVVNTSSTPNSVPVVDDVEFSDTEDMLEGIRNVVDKVSIEDTCDELV------ 321

  Fly   291 FRHGLIHDSEHSTMRQSPMTQVP---SNRAD--FNELLLDGEMLIDNDPAFATSNQNTNPPKKEM 350
                   |.|   :..|.|| .|   :|..|  |..|||.||    ..||   |::...|..|| 
  Fly   322 -------DLE---LTSSGMT-APWFNNNFRDITFPALLLPGE----PPPA---SSEPATPLLKE- 367

  Fly   351 FSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECT---ACDIQMNTAKEASIHFQTDCI 412
              :..:|..:..:|.....||..|          |.:.|.|   ||:....|...|....||..|
  Fly   368 --NPHVGDHMALDFLSPEKADPQE----------EAKLEKTLSKACEPNEQTLLVAPPACQTPPI 420

  Fly   413 -------FMREAIRSLNVTLSRYFVC------------------------NVC-ELKFANTDLLQ 445
                   ...|.:|...:.||..|..                        |.| :::..:|.|.:
  Fly   421 PTVPPANSSIEQLRRSPLELSEAFKLEEDDMTDSRPASSFEEGDPDAEEPNECFQMEVLDTSLTE 485

  Fly   446 EHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQ 510
            |..          |:..:|..  ||.|:      .||.::      |..|..:.|.|    :.|.
  Fly   486 EAE----------NKTRRKHF--CDKCN------RDFNSY------NALKYHQYTHN----QERS 522

  Fly   511 YLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVC 575
            :.||.|.:|:...|.|..|.|.|.|||||.|  :.|:.:|....||..||...|:..:.::|..|
  Fly   523 HKCDSCERSFYTQSALKAHERTHSGVKPFKC--DKCEFQFRQWGDLKYHIISRHSDVKAHMCEFC 585

  Fly   576 GKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGD 640
            ||.|........||.||..|:.|.|:.|.|.|..:..|.:|.::||||:||.|..|.|.||..||
  Fly   586 GKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLLSHIKVHTGERPYECSICEKKFRVSGD 650

  Fly   641 RDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVA 688
            ..:|.|..    |.:.......:|.:.:.|||...|.  |.::|:::|
  Fly   651 LKRHSRIH----DPSRTSQPPAEKAKKKRAAASNKQL--PIEEDDELA 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 2/20 (10%)
C2H2 Zn finger 277..297 CDD:275368 1/23 (4%)
C2H2 Zn finger 431..453 CDD:275368 5/46 (11%)
COG5048 <450..647 CDD:227381 65/196 (33%)
C2H2 Zn finger 469..490 CDD:275368 5/20 (25%)
zf-C2H2 511..533 CDD:278523 8/21 (38%)
C2H2 Zn finger 513..564 CDD:275368 21/50 (42%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 10/25 (40%)
C2H2 Zn finger 572..592 CDD:275368 7/19 (37%)
zf-H2C2_2 585..609 CDD:290200 10/23 (43%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 612..637 CDD:290200 12/24 (50%)
C2H2 Zn finger 628..646 CDD:275368 8/17 (47%)
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 64/181 (35%)
C2H2 Zn finger 497..517 CDD:275368 7/31 (23%)
zf-H2C2_2 509..534 CDD:290200 8/28 (29%)
C2H2 Zn finger 525..545 CDD:275368 8/19 (42%)
zf-H2C2_2 537..562 CDD:290200 12/26 (46%)
C2H2 Zn finger 555..574 CDD:275371 6/18 (33%)
zf-C2H2 580..602 CDD:278523 7/21 (33%)
C2H2 Zn finger 582..602 CDD:275368 7/19 (37%)
zf-H2C2_2 594..617 CDD:290200 9/22 (41%)
C2H2 Zn finger 610..630 CDD:275368 6/19 (32%)
zf-H2C2_2 622..645 CDD:290200 11/22 (50%)
zf-C2H2 636..658 CDD:278523 10/21 (48%)
C2H2 Zn finger 638..658 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.