DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG8944

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:473 Identity:97/473 - (20%)
Similarity:163/473 - (34%) Gaps:130/473 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGR----IFYDPQV 289
            ||.....:..:.|.|....|.|.|:.:.|...:..        ..|||..|..|    |:.|...
  Fly   321 ECNRMALEKTNISTLWYFKELHFLNEVYSYNDKMS--------DAVVKETSYRRRFSAIWNDTST 377

  Fly   290 AFRHGLIHDSEHSTMRQSPMTQVPSNRAD-FNELLLDGEMLID----------NDPAFATSNQNT 343
            |....::...:....|..|..:....|.: .:::.::.:.|||          :...|..|.|  
  Fly   378 AKLLSMVKRYQCFYNRFDPDYRSKERRGEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQ-- 440

  Fly   344 NPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAE---RRFECTACDIQMNTAKEASI 405
               |.|..:|..||...           ||..|.:...|..:   ..|:|..|...:.|.:|..:
  Fly   441 ---KMERLNSERLGKKF-----------IANYLYYDQMHFMDDDIPPFKCAHCPEIVQTLRELDL 491

  Fly   406 HFQTDCIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENG-KKLLLPC 469
            |..|.           ..:|...:.||:|.::|.|......|:        :|:..| .::...|
  Fly   492 HMLTH-----------QPSLGGGYYCNICSIQFHNAQEFDNHK--------QLHLGGVTEIKFNC 537

  Fly   470 DFCDVNFEFAHDFLAHSEEKHLNKKKRE--------------------------KETRNTGAGRI 508
            :.|..:|....::     ::||.:...|                          :|:|.:|:.|.
  Fly   538 ELCTASFREKANY-----DEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGSRRK 597

  Fly   509 RQ----------------------------------YLCDICGKSYTQSSHLWQHLRFHQGVKP- 538
            |:                                  |.||:|.:|:....||..|...||..:. 
  Fly   598 RRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERER 662

  Fly   539 -FVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEE 602
             :.|....|::.|..|..|.:|::: |.....:.|.:|||.|.:......|:.||...:||.|:.
  Fly   663 CYKCDYPQCNKSFVARNSLFEHLKQ-HYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQI 726

  Fly   603 CGKRFYRADALKNHQRIH 620
            ||..|.:|..|..|:|.|
  Fly   727 CGSAFAQAAGLYLHKRRH 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 4/19 (21%)
C2H2 Zn finger 277..297 CDD:275368 5/23 (22%)
C2H2 Zn finger 431..453 CDD:275368 6/21 (29%)
COG5048 <450..647 CDD:227381 49/234 (21%)
C2H2 Zn finger 469..490 CDD:275368 3/20 (15%)
zf-C2H2 511..533 CDD:278523 8/21 (38%)
C2H2 Zn finger 513..564 CDD:275368 15/52 (29%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 8/25 (32%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 9/23 (39%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 8/19 (42%)
zf-H2C2_2 612..637 CDD:290200 4/9 (44%)
C2H2 Zn finger 628..646 CDD:275368
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510 6/22 (27%)
MADF 379..472 CDD:214738 18/108 (17%)
C2H2 Zn finger 476..496 CDD:275368 5/19 (26%)
C2H2 Zn finger 506..526 CDD:275368 6/27 (22%)
C2H2 Zn finger 537..557 CDD:275368 5/24 (21%)
C2H2 Zn finger 636..656 CDD:275368 7/19 (37%)
zf-C2H2_8 639..712 CDD:292531 19/73 (26%)
C2H2 Zn finger 666..688 CDD:275368 6/22 (27%)
zf-C2H2 694..716 CDD:278523 6/21 (29%)
C2H2 Zn finger 696..716 CDD:275368 6/19 (32%)
zf-H2C2_2 708..733 CDD:290200 9/24 (38%)
C2H2 Zn finger 724..744 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.