DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and CG11696

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:434 Identity:96/434 - (22%)
Similarity:145/434 - (33%) Gaps:121/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 ATSNQNTN--PPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNT 399
            |..|.:|:  |.|:....          |..:||.|::              :.:|..|...:..
  Fly   271 ADDNDDTSEVPVKRSSIK----------EMDDYIAANV--------------KLDCAICAAPLED 311

  Fly   400 AKEASIHFQTD--------CIFMREAIRSLNVTL------SRYFVCNVCELKFANTDLLQEHRCT 450
            ..:...||:.:        |...|...|:|.|..      .:||.|..|...|.|       |.:
  Fly   312 FNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLN-------RNS 369

  Fly   451 SFHYFPRLNENGKKLLLPCDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDI 515
            ...:..|.:...::|:..|..|:.  .||..||.   ..||...|          |..|..:||.
  Fly   370 QVMHMLRFHSQQQELVHQCAICEA--RFAKKFLL---TMHLKGHK----------GTERPEVCDT 419

  Fly   516 CGKSYTQSSHLWQHL-RFHQG-VKPFVCQEENCDRKF-----------TIRPD------------ 555
            |.|::.....|..|: |.|.. ..|.:|  :.|...|           .:.||            
  Fly   420 CSKTFRTKFELSAHVKRMHAADFTPIIC--DICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCG 482

  Fly   556 --------LNDHIRKCH---TGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYR 609
                    |..|:.: |   .|:..|.||:|.....:.:....|...|...:|::|..|.|.|..
  Fly   483 RWLRDERSLRKHLAR-HDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKL 546

  Fly   610 ADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQ-KFQLETAAAQ 673
            ..||..|...|||...|.|.|||:||:...:...|.:..|    .|..:....| ...:.:.||.
  Fly   547 PRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMH----PNDWVRKYSQPSSSITSTAAP 607

  Fly   674 KAQSHNPEQQDNDVA-------------GGASTS--DVPSGSGF 702
            .|..::|.|.....|             ||.:.|  ::|...||
  Fly   608 LAHPNHPNQPAPPAAAPTNLAGHMLPPLGGIAKSLIEIPDTEGF 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 5/21 (24%)
COG5048 <450..647 CDD:227381 56/232 (24%)
C2H2 Zn finger 469..490 CDD:275368 6/20 (30%)
zf-C2H2 511..533 CDD:278523 7/22 (32%)
C2H2 Zn finger 513..564 CDD:275368 16/83 (19%)
C2H2 Zn finger 541..561 CDD:275368 7/50 (14%)
zf-H2C2_2 555..581 CDD:290200 9/48 (19%)
C2H2 Zn finger 572..592 CDD:275368 4/19 (21%)
zf-H2C2_2 585..609 CDD:290200 7/23 (30%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 13/24 (54%)
C2H2 Zn finger 628..646 CDD:275368 7/17 (41%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 4/16 (25%)
C2H2 Zn finger 357..378 CDD:275368 6/27 (22%)
C2H2 Zn finger 388..408 CDD:275368 8/24 (33%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 3/19 (16%)
C2H2 Zn finger 478..498 CDD:275368 2/20 (10%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..583 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.