| Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008761109.1 | Gene: | Zfp746 / 312303 | RGDID: | 1306209 | Length: | 656 | Species: | Rattus norvegicus |
| Alignment Length: | 219 | Identity: | 57/219 - (26%) |
|---|---|---|---|
| Similarity: | 80/219 - (36%) | Gaps: | 66/219 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 518 KSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKC-------------HTG--- 566
Fly 567 ----------------ERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKN 615
Fly 616 HQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHN- 679
Fly 680 --------PEQQDNDVAGG--AST 693 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
| C2H2 Zn finger | 277..297 | CDD:275368 | |||
| C2H2 Zn finger | 431..453 | CDD:275368 | |||
| COG5048 | <450..647 | CDD:227381 | 43/160 (27%) | ||
| C2H2 Zn finger | 469..490 | CDD:275368 | |||
| zf-C2H2 | 511..533 | CDD:278523 | 3/14 (21%) | ||
| C2H2 Zn finger | 513..564 | CDD:275368 | 13/58 (22%) | ||
| C2H2 Zn finger | 541..561 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 555..581 | CDD:290200 | 10/57 (18%) | ||
| C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 585..609 | CDD:290200 | 12/23 (52%) | ||
| zf-C2H2 | 598..620 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 600..620 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 612..637 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 628..646 | CDD:275368 | 4/17 (24%) | ||
| Zfp746 | XP_008761109.1 | KRAB | 113..162 | CDD:214630 | |
| KRAB_A-box | <114..141 | CDD:143639 | |||
| COG5048 | <522..600 | CDD:227381 | 32/98 (33%) | ||
| zf-C2H2 | 522..543 | CDD:278523 | 6/20 (30%) | ||
| C2H2 Zn finger | 523..543 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 535..559 | CDD:290200 | 11/23 (48%) | ||
| zf-C2H2 | 549..571 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 551..571 | CDD:275368 | 9/19 (47%) | ||
| zf-C2H2 | 577..599 | CDD:278523 | 9/42 (21%) | ||
| C2H2 Zn finger | 579..599 | CDD:275368 | 9/40 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||