DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ZNF660

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_775929.2 Gene:ZNF660 / 285349 HGNCID:26720 Length:331 Species:Homo sapiens


Alignment Length:392 Identity:109/392 - (27%)
Similarity:167/392 - (42%) Gaps:79/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 EHSTMRQSPMTQVPSNRADFNELLLDG---EMLIDN----DPAFATSNQNTNPPKKEMFSSLILG 357
            :|.|::.             |::|.:|   |...||    |||   :|:.....|::..      
Human     9 KHKTVKD-------------NKVLTEGSDQESEKDNSQCCDPA---TNERVQAEKRQYV------ 51

  Fly   358 SVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHFQTDCIFMREAIRSLN 422
                |..|...|:..|.|.||...|..|:.::|..|....:.:....:|            |.::
Human    52 ----CTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVH------------RRIH 100

  Fly   423 VTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDFLAHSE 487
            ..|..| .|:.|...|:....|..|:  ..|       :|:| ...|..|...|..:...::| .
Human   101 TGLKPY-TCSECGKSFSGKSHLIRHQ--GIH-------SGEK-TYECKECGKAFSRSSGLISH-H 153

  Fly   488 EKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTI 552
            ..|..:|               .|.|..|||::::||:|.||.|.|:|.|.:.|:|  |.:....
Human   154 RVHTGEK---------------PYSCIECGKAFSRSSNLTQHQRMHRGKKVYKCKE--CGKTCGS 201

  Fly   553 RPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQ 617
            ...:.|| ::.||||:||.|..|||.|:......:|:.:||.|:.|:|.||||.|.....|.:||
Human   202 NTKIMDH-QRIHTGEKPYECDECGKTFILRKTLNEHQRLHRREKPYKCNECGKAFTSNRNLVDHQ 265

  Fly   618 RIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQK-FQLETAAAQKAQSHNPE 681
            |:|||||||.|..|.|||||......|:|   :|.........:..| ::..:...|..:.||.|
Human   266 RVHTGEKPYKCNECGKTFRQTSQVILHLR---THTKEKPYKCSECGKAYRYSSQLIQHQRKHNEE 327

  Fly   682 QQ 683
            ::
Human   328 KE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 5/21 (24%)
COG5048 <450..647 CDD:227381 69/196 (35%)
C2H2 Zn finger 469..490 CDD:275368 4/20 (20%)
zf-C2H2 511..533 CDD:278523 11/21 (52%)
C2H2 Zn finger 513..564 CDD:275368 18/50 (36%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
zf-H2C2_2 555..581 CDD:290200 13/25 (52%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 11/23 (48%)
zf-C2H2 598..620 CDD:278523 11/21 (52%)
C2H2 Zn finger 600..620 CDD:275368 10/19 (53%)
zf-H2C2_2 612..637 CDD:290200 16/24 (67%)
C2H2 Zn finger 628..646 CDD:275368 8/17 (47%)
ZNF660NP_775929.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 8/38 (21%)
C2H2 Zn finger 52..72 CDD:275368 7/19 (37%)
zf-H2C2_2 64..89 CDD:316026 7/24 (29%)
C2H2 Zn finger 80..100 CDD:275368 4/31 (13%)
COG5048 <107..294 CDD:227381 74/215 (34%)
C2H2 Zn finger 108..128 CDD:275368 5/21 (24%)
C2H2 Zn finger 136..156 CDD:275368 4/20 (20%)
C2H2 Zn finger 164..184 CDD:275368 10/19 (53%)
C2H2 Zn finger 192..207 CDD:275368 3/16 (19%)
C2H2 Zn finger 220..240 CDD:275368 6/19 (32%)
C2H2 Zn finger 248..268 CDD:275368 10/19 (53%)
C2H2 Zn finger 276..296 CDD:275368 9/22 (41%)
C2H2 Zn finger 304..324 CDD:275368 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.