DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and Zfp146

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001344486.1 Gene:Zfp146 / 26465 MGIID:1347092 Length:292 Species:Mus musculus


Alignment Length:429 Identity:109/429 - (25%)
Similarity:146/429 - (34%) Gaps:155/429 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRIFYDPQVAF 291
            |..|.:|.:.|.|.|.|..|...|        :.|:|           .:||.||:.|...|...
Mouse    15 PFACKVCGKLFSHKSNLTEHEHFH--------SREKP-----------FECNECGKAFSQKQYVI 60

  Fly   292 RHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNPPKKEMFSSLIL 356
            :    |.|.||                       ||.|                           
Mouse    61 K----HQSTHS-----------------------GEKL--------------------------- 71

  Fly   357 GSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACD---IQ-MNTAKEASIHFQTDCIFMREA 417
               .:|..|...|:....||.|...|..|:.|||..|.   || .|..:....|           
Mouse    72 ---FECSDCGKAFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTH----------- 122

  Fly   418 IRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDF 482
                  |..:.|:|..|...|:....|.||                                   
Mouse   123 ------TGEKPFICKECGKTFSGKSNLTEH----------------------------------- 146

  Fly   483 LAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCD 547
                |:.|:.:|               .:.|:.||.::.|..:|.:|...|.|.||:.|.|  |.
Mouse   147 ----EKIHIGEK---------------PFKCNECGTAFGQKKYLIKHQNIHTGEKPYECNE--CG 190

  Fly   548 RKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADA 612
            :.|:.|..|..|:| .|:|::||.|.||||.|...|....|...|.||:.|.|.||||.|.:...
Mouse   191 KAFSQRTSLIVHVR-IHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFST 254

  Fly   613 LKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSH 651
            |..|.|||||:|||.|..|.|.|.|:....:|.:. |:|
Mouse   255 LALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKI-HTH 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..453 CDD:275368 6/21 (29%)
COG5048 <450..647 CDD:227381 59/196 (30%)
C2H2 Zn finger 469..490 CDD:275368 1/20 (5%)
zf-C2H2 511..533 CDD:278523 6/21 (29%)
C2H2 Zn finger 513..564 CDD:275368 18/50 (36%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 13/25 (52%)
C2H2 Zn finger 572..592 CDD:275368 8/19 (42%)
zf-H2C2_2 585..609 CDD:290200 11/23 (48%)
zf-C2H2 598..620 CDD:278523 10/21 (48%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 14/24 (58%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
Zfp146NP_001344486.1 COG5048 <1..260 CDD:227381 93/394 (24%)
C2H2 Zn finger 18..38 CDD:275368 7/19 (37%)
C2H2 Zn finger 46..66 CDD:275368 8/23 (35%)
C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)
C2H2 Zn finger 102..122 CDD:275368 5/19 (26%)
C2H2 Zn finger 130..150 CDD:275368 7/58 (12%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 186..206 CDD:275368 8/22 (36%)
Interaction with TERF2IP. /evidence=ECO:0000250 212..292 36/80 (45%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
C2H2 Zn finger 242..262 CDD:275368 9/19 (47%)
zf-H2C2_2 255..279 CDD:404364 14/23 (61%)
C2H2 Zn finger 270..290 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.