Sequence 1: | NP_649945.1 | Gene: | topi / 41199 | FlyBaseID: | FBgn0037751 | Length: | 814 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_320526.4 | Gene: | AgaP_AGAP012007 / 1280665 | VectorBaseID: | AGAP012007 | Length: | 257 | Species: | Anopheles gambiae |
Alignment Length: | 263 | Identity: | 65/263 - (24%) |
---|---|---|---|
Similarity: | 99/263 - (37%) | Gaps: | 62/263 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 486 SEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKF 550
Fly 551 TIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGE-------------------- 595
Fly 596 ----------------RRYECEECGKRFYRADALKNHQRIHT-GEKPYSCLFCTKTFRQRGDRDK 643
Fly 644 HIRARHSHL-DANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAGGASTSDVPSGSGFMSTEP 707
Fly 708 SVA 710 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
topi | NP_649945.1 | C2H2 Zn finger | 230..250 | CDD:275368 | |
C2H2 Zn finger | 277..297 | CDD:275368 | |||
C2H2 Zn finger | 431..453 | CDD:275368 | |||
COG5048 | <450..647 | CDD:227381 | 52/197 (26%) | ||
C2H2 Zn finger | 469..490 | CDD:275368 | 2/3 (67%) | ||
zf-C2H2 | 511..533 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 513..564 | CDD:275368 | 17/50 (34%) | ||
C2H2 Zn finger | 541..561 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 555..581 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 572..592 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 585..609 | CDD:290200 | 10/59 (17%) | ||
zf-C2H2 | 598..620 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 600..620 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 612..637 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 628..646 | CDD:275368 | 7/17 (41%) | ||
AgaP_AGAP012007 | XP_320526.4 | C2H2 Zn finger | 29..49 | CDD:275368 | 9/19 (47%) |
C2H2 Zn finger | 57..79 | CDD:275368 | 5/22 (23%) | ||
C2H2 Zn finger | 87..104 | CDD:275368 | 4/16 (25%) | ||
C2H2 Zn finger | 121..140 | CDD:275368 | 0/18 (0%) | ||
C2H2 Zn finger | 151..171 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 8/22 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |