DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and Prdm1

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_006512568.1 Gene:Prdm1 / 12142 MGIID:99655 Length:856 Species:Mus musculus


Alignment Length:180 Identity:61/180 - (33%)
Similarity:95/180 - (52%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 GRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPY 570
            |:|: |.|::|.|::.|.|:|..|||.|.|.:||.||  .|::.||....|..|. ..||||:|:
Mouse   602 GKIK-YECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHY-LVHTGEKPH 662

  Fly   571 LCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTF 635
            .|.||.|||.:.|....|..:|.||:.|:|:.|..:|.:...||.|:|:||.|:|:.|..|.|::
Mouse   663 ECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSY 727

  Fly   636 RQRGDRDKHIRARHSHLDAN--------------SRLMMQMQKFQLETAA 671
                   .|:.:...||..|              :|:..::::|.:...|
Mouse   728 -------IHLCSLKVHLKGNCPAGPAAGLPLEDLTRINEEIERFDISDNA 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 55/140 (39%)
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523 10/21 (48%)
C2H2 Zn finger 513..564 CDD:275368 20/50 (40%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 13/25 (52%)
C2H2 Zn finger 572..592 CDD:275368 8/19 (42%)
zf-H2C2_2 585..609 CDD:290200 8/23 (35%)
zf-C2H2 598..620 CDD:278523 8/21 (38%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 11/24 (46%)
C2H2 Zn finger 628..646 CDD:275368 4/17 (24%)
Prdm1XP_006512568.1 PR-SET_PRDM1 112..240 CDD:380964
COG5048 452..719 CDD:227381 51/120 (43%)
C2H2 Zn finger 608..628 CDD:275368 9/19 (47%)
C2H2 Zn finger 636..656 CDD:275368 7/22 (32%)
C2H2 Zn finger 664..684 CDD:275368 8/19 (42%)
C2H2 Zn finger 692..712 CDD:275368 7/19 (37%)
C2H2 Zn finger 720..738 CDD:275368 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.