DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and AgaP_AGAP012950

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_003435799.1 Gene:AgaP_AGAP012950 / 11175862 VectorBaseID:AGAP012950 Length:712 Species:Anopheles gambiae


Alignment Length:152 Identity:42/152 - (27%)
Similarity:65/152 - (42%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 GERR----YECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHL-- 652
            |:|:    :.|..|.|.|....::..|.|.||||||::|..|.|:|||:....||.:   :||  
Mosquito   561 GQRKERSLHYCSICSKGFKDKYSVNVHIRTHTGEKPFACSLCGKSFRQKAHLAKHYQ---THLAQ 622

  Fly   653 --DANSRLMMQMQKFQLET--AAAQKAQSHNPEQQDNDVAGGASTSDVPSGSGFMSTEPSVAEMQ 713
              .....:..|.::.:|.|  ||:..|.|.....|...||     |..|.....:|....:..| 
Mosquito   623 KNPPGGTVTKQSKQSRLSTPLAASSSAGSDPSTGQSMPVA-----SVTPVTLSVVSVAGPLPPM- 681

  Fly   714 YSITPEQQEEMVCVPIDEVNNS 735
              :.|:.|...:.:.....||:
Mosquito   682 --VIPQAQSPPMLLTTTTTNNN 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 22/56 (39%)
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523
C2H2 Zn finger 513..564 CDD:275368
C2H2 Zn finger 541..561 CDD:275368
zf-H2C2_2 555..581 CDD:290200
C2H2 Zn finger 572..592 CDD:275368
zf-H2C2_2 585..609 CDD:290200 6/18 (33%)
zf-C2H2 598..620 CDD:278523 6/21 (29%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 612..637 CDD:290200 12/24 (50%)
C2H2 Zn finger 628..646 CDD:275368 8/17 (47%)
AgaP_AGAP012950XP_003435799.1 COG5048 568..>660 CDD:227381 30/94 (32%)
zf-C2H2 569..591 CDD:278523 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275370 6/19 (32%)
zf-H2C2_2 583..608 CDD:290200 12/24 (50%)
C2H2 Zn finger 599..619 CDD:275370 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.