DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and ERV3-1-ZNF117

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001334979.1 Gene:ERV3-1-ZNF117 / 109504726 -ID:- Length:483 Species:Homo sapiens


Alignment Length:636 Identity:147/636 - (23%)
Similarity:219/636 - (34%) Gaps:212/636 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ERIVSHEELSRFFA--VGPAGALPMPTDVVVERTLADPAFKQILQEADGKKGFDPQAEQMKIR-- 104
            |.:..|..:..:||  :.|            |:.:.| :|:::......|.|:    |.:::|  
Human     5 EMVAKHLVMFYYFAQHLWP------------EQNIRD-SFQKVTLRRYRKCGY----ENLQLRKG 52

  Fly   105 ------------DFLAGVTSSKMTTEQSVFHGSR--------SNSS----ASTVNR-IKCPTCLV 144
                        |: :|:.....||...:|..::        |||:    ..|.|: .||..|..
Human    53 CKSVVECKQHKGDY-SGLNQCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRK 116

  Fly   145 QFDAVAFQNHSCEAKPIEVAVPQQEKPHLVPTVSAPPAPLSKPASERVIRENQVRLRRYIKDEMK 209
            .|   ...:|..:.|.|:..|                                    .:.|.| .
Human   117 TF---CMLSHLTQHKRIQTRV------------------------------------NFYKCE-A 141

  Fly   210 YDLATGIESS-----RKNAAKGPNECTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAA 269
            |..|....|:     |.:..:.|.:|..|.:.|...|.|:||...|        |.|:|:     
Human   142 YGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHLIRHKRIH--------TEEKPY----- 193

  Fly   270 GLHVVVKCNSCGRIFYDPQVAFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDP 334
                  ||..||:.|........|.:||..|           :|                     
Human   194 ------KCEECGKAFNQSSTLTTHNIIHTGE-----------IP--------------------- 220

  Fly   335 AFATSNQNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECTACDIQMNT 399
                                     .:||.|...|...::|..|...|..|:|:||..|....|.
Human   221 -------------------------YKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNR 260

  Fly   400 AKEASIHFQTDCIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRLNENGKK 464
            :.:.:.|....             |..:.:.|..|...|..:..|..|:        |::...|.
Human   261 SSKLTEHKYIH-------------TGEKLYKCEECGKAFNQSSTLTTHK--------RIHSGEKP 304

  Fly   465 LLLPCDFCDVNF-EFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQ 528
              ..|:.|...| :|::  |...::.|..:|               .|.|:.|||::.|.|:|.:
Human   305 --YKCEECGKAFKQFSN--LTDHKKIHTGEK---------------PYKCEECGKAFNQLSNLTR 350

  Fly   529 HLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHR 593
            |...|.|.||:.|.|  |.:.|.....||.| :..||||.|:.|...||.|...|.....:.||.
Human   351 HKVIHTGEKPYKCGE--CGKAFNQSSALNTH-KIIHTGENPHKCRESGKVFHLSSKLSTCKKIHT 412

  Fly   594 GERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKH 644
            ||:.|:||||||.|.|:..|..|:|||||||||.|..|.|.|.|......|
Human   413 GEKLYKCEECGKAFNRSSTLIGHKRIHTGEKPYKCEECGKAFNQSSTLTTH 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..453 CDD:275368 5/21 (24%)
COG5048 <450..647 CDD:227381 69/196 (35%)
C2H2 Zn finger 469..490 CDD:275368 5/21 (24%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 19/50 (38%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 12/25 (48%)
C2H2 Zn finger 572..592 CDD:275368 5/19 (26%)
zf-H2C2_2 585..609 CDD:290200 12/23 (52%)
zf-C2H2 598..620 CDD:278523 12/21 (57%)
C2H2 Zn finger 600..620 CDD:275368 11/19 (58%)
zf-H2C2_2 612..637 CDD:290200 15/24 (63%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
ERV3-1-ZNF117NP_001334979.1 C2H2 Zn finger 111..131 CDD:275368 5/22 (23%)
C2H2 Zn finger 139..159 CDD:275368 5/20 (25%)
COG5048 163..>475 CDD:227381 111/420 (26%)
C2H2 Zn finger 167..187 CDD:275368 7/19 (37%)
C2H2 Zn finger 195..215 CDD:275368 5/19 (26%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
C2H2 Zn finger 251..271 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..299 CDD:275368 6/27 (22%)
C2H2 Zn finger 307..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 7/22 (32%)
C2H2 Zn finger 391..407 CDD:275368 5/15 (33%)
C2H2 Zn finger 419..439 CDD:275368 11/19 (58%)
C2H2 Zn finger 447..467 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.