DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and LOC100535691

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_003198149.4 Gene:LOC100535691 / 100535691 -ID:- Length:493 Species:Danio rerio


Alignment Length:248 Identity:65/248 - (26%)
Similarity:97/248 - (39%) Gaps:62/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 PRLNENGKKLLLPCDFCDVNFEFAHDF----LAHSEEKHLNKKKREKETRNTGAGRIRQYLCDIC 516
            |..|.|..:....|:.|...|...:..    |:||:||                    .|.|.||
Zfish   226 PNPNPNPVRKNHACEACGKAFRDVYHLNRHRLSHSDEK--------------------PYSCPIC 270

  Fly   517 GKSYTQSSHLWQHLRFHQG--VKPFVCQEENCDRKFTIRPD-LNDHIRKCHTGERPYLCLVCGKR 578
            .:.:.:...:..|:|.|||  .||:||  .:|.:.|: ||| ||.|:|:.|:.|||:.|..|...
Zfish   271 QQRFKRKDRMSYHVRSHQGGVEKPYVC--PHCAKGFS-RPDHLNSHVRQVHSTERPFKCPTCESA 332

  Fly   579 FLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDK 643
            |.|......|.:.|  |.:..|..|||....| .:.:|.|:|...:.:.|..|.::|...    .
Zfish   333 FATKDRLRAHMIRH--EDKVPCHICGKLLSPA-YITDHMRVHNQSQHHVCHLCNRSFTTL----T 390

  Fly   644 HIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSHNPEQQDNDVAGGASTSDV 696
            ::|..                       |||  .|..|.:|:.|..|:....|
Zfish   391 YLRVH-----------------------AQK--HHGQEWKDSGVGRGSGPGGV 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 55/197 (28%)
C2H2 Zn finger 469..490 CDD:275368 7/24 (29%)
zf-C2H2 511..533 CDD:278523 6/21 (29%)
C2H2 Zn finger 513..564 CDD:275368 21/53 (40%)
C2H2 Zn finger 541..561 CDD:275368 9/20 (45%)
zf-H2C2_2 555..581 CDD:290200 12/26 (46%)
C2H2 Zn finger 572..592 CDD:275368 5/19 (26%)
zf-H2C2_2 585..609 CDD:290200 7/23 (30%)
zf-C2H2 598..620 CDD:278523 7/21 (33%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 6/24 (25%)
C2H2 Zn finger 628..646 CDD:275368 3/17 (18%)
LOC100535691XP_003198149.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.