DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and adprm.2

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_002935983.2 Gene:adprm.2 / 100498212 XenbaseID:XB-GENE-22063717 Length:337 Species:Xenopus tropicalis


Alignment Length:294 Identity:51/294 - (17%)
Similarity:88/294 - (29%) Gaps:100/294 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ADPAFKQILQEADGKKGFDPQAEQMKIRDFLAGVTSSKMTTEQSVFHGSRSNSSASTVNRIKCPT 141
            ::.|.:::||..:|.||                           .:|....|.......|    :
 Frog    84 SENALEKVLQVTEGMKG---------------------------RWHHVWGNHELYNFKR----S 117

  Fly   142 CLVQFDAVAFQNHSCEAKPIEVAVPQQEKPHLVPTVSAPPAPLSKPASERVIRENQVRLRRYIKD 206
            .|||        .....:|:|..:|..|:.......:...:|..             |.|..:.|
 Frog   118 YLVQ--------SKLNTRPMEDPIPDIERGEAADYYAYHFSPYP-------------RFRFVVID 161

  Fly   207 EMKYDLAT-GIESSRKN--------------AAKGPNECTMCDRKFVHASGLVRHMEKHALDLIP 256
              .|||:: |.:.:..|              ...|.::....:|:.|:.:|.|...:...|..|.
 Frog   162 --TYDLSSLGRDMNHPNYQASIAFVTQSCSPEEPGDSKARKHERQLVNFNGGVGKEQLSWLHKIL 224

  Fly   257 SQTSEQPHTIPAAG---LHVVVKCNSCGRIFYDP--QVAFRHGLI-----------------HDS 299
            :...||...:..|.   :|...:..:|....|..  .|..||..:                 |..
 Frog   225 TYADEQEEKVVIASHVPIHPNAQVTNCLAWNYSEILDVLHRHSCVVSYIAGHEHHGAYCQDSHGI 289

  Fly   300 EHSTMRQSPMTQVPSNRADF-------NELLLDG 326
            .|.||  ..:.:.|.|...|       |:::|.|
 Frog   290 HHITM--EGVIESPPNTNAFATVHMYKNKMVLHG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 4/19 (21%)
C2H2 Zn finger 277..297 CDD:275368 5/38 (13%)
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523
C2H2 Zn finger 513..564 CDD:275368
C2H2 Zn finger 541..561 CDD:275368
zf-H2C2_2 555..581 CDD:290200
C2H2 Zn finger 572..592 CDD:275368
zf-H2C2_2 585..609 CDD:290200
zf-C2H2 598..620 CDD:278523
C2H2 Zn finger 600..620 CDD:275368
zf-H2C2_2 612..637 CDD:290200
C2H2 Zn finger 628..646 CDD:275368
adprm.2XP_002935983.2 MPP_Nbla03831 17..319 CDD:277341 49/290 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.