DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment topi and znf653

DIOPT Version :9

Sequence 1:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_002661160.3 Gene:znf653 / 100329742 ZFINID:ZDB-GENE-071116-3 Length:369 Species:Danio rerio


Alignment Length:304 Identity:68/304 - (22%)
Similarity:105/304 - (34%) Gaps:87/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 RPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQ 617
            ||.|.|..|              .:|.|.....|..|.::.||......|..:|...:||     
Zfish    25 RPRLTDADR--------------AQRRLESRKKYDVRRVYLGEAHQVWSELRRRTSLSDA----- 70

  Fly   618 RIHTGEKPYSCLFCT---KTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQSH- 678
                |...|..|..:   :.:||:..|.|.:..::|    ..|...::....||...:. .||| 
Zfish    71 ----GLAKYLILLNSAYGEKYRQKYVRRKPLHEQYS----THRKGKKVSATSLENVVSW-YQSHC 126

  Fly   679 -----NPEQQDNDVAGGASTS---DVPSGSGFMSTEP------SVAEMQYS-ITPEQQEEMV--- 725
                 .||.::.:...|.|||   ...:|..|:...|      |.::::.| :..|::||.|   
Zfish   127 QSCPNEPELREVEPTVGLSTSALWQCAAGHSFVQYLPWPAGGESESDVEDSAVEKEEEEESVTER 191

  Fly   726 ---CVPIDEVNNS----FFMSHY-MQAVPME-----EDGSGQHIIVFEQPGQNMDMMSIYDQQQV 777
               ...|:|.||:    ...:|. :|....|     :|....|:      |..|...|:.|..  
Zfish   192 KKKTTVINERNNNKRKRRIQNHRDLQDAGNELEEEDDDDPASHM------GHQMSCTSLNDLP-- 248

  Fly   778 GEP---------------MHESGVPKRPAEENARVVVVKNNPTK 806
            |.|               |....||:..||.:.| ....|:|.|
Zfish   249 GSPAAHSPPASGASPVWEMEALMVPESQAESSER-TSGGNDPAK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368
COG5048 <450..647 CDD:227381 22/96 (23%)
C2H2 Zn finger 469..490 CDD:275368
zf-C2H2 511..533 CDD:278523
C2H2 Zn finger 513..564 CDD:275368 5/10 (50%)
C2H2 Zn finger 541..561 CDD:275368 4/7 (57%)
zf-H2C2_2 555..581 CDD:290200 4/25 (16%)
C2H2 Zn finger 572..592 CDD:275368 4/19 (21%)
zf-H2C2_2 585..609 CDD:290200 6/23 (26%)
zf-C2H2 598..620 CDD:278523 4/21 (19%)
C2H2 Zn finger 600..620 CDD:275368 4/19 (21%)
zf-H2C2_2 612..637 CDD:290200 4/27 (15%)
C2H2 Zn finger 628..646 CDD:275368 5/20 (25%)
znf653XP_002661160.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.