DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Whamy and B0280.2

DIOPT Version :9

Sequence 1:NP_001036699.1 Gene:Whamy / 41198 FlyBaseID:FBgn0037750 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_498557.3 Gene:B0280.2 / 175996 WormBaseID:WBGene00015100 Length:627 Species:Caenorhabditis elegans


Alignment Length:409 Identity:83/409 - (20%)
Similarity:138/409 - (33%) Gaps:125/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 EISGPVNFQHVSGDVTRDRTRNAFDLNADPNDKVLRKYMMERGITEADISDMRRQE--VIKKIIH 252
            ||..|.:|:||.|....|...:.:....:|.::.:.|.::.|.......|.|.::|  .:|::..
 Worm   171 EIEAPTDFRHVDGVKLTDVQEDLYMQVNNPEEEEIVKQLIVRNEDHIRQSLMVKKESQTVKEVKD 235

  Fly   253 SNFTWMPPKSDL--QAQPKVQDHARPLLYATISTNNQITP----------------PPSPPPPPI 299
            .|...:......  :.:|||:|.::|::  .:.|.:.:.|                ...|...|.
 Worm   236 KNKDKVKTSKSFFGRNKPKVEDVSQPIV--PVITGDPLNPDWTVTAATSFKHSHTFSADPIKDPS 298

  Fly   300 ATISRPTEAPNFSNYASLTSRFVDISDMDLPAPTPAAPT---PFQPAEVGSVIPVQVQPQQSVKP 361
            ..::|.|   :.....||:              ||..||   .::.|.....:|.|.        
 Worm   299 VLLNRST---SVRVRGSLS--------------TPRIPTHRDSYRSATKPDTVPKQT-------- 338

  Fly   362 KVPPPPSAVMAKNTHGYPAAIDIRQVRPSVAPK---------------------VANETYATISP 405
               |||:    .|::..| .||.|..|..:..|                     ..|.|:.:..|
 Worm   339 ---PPPT----HNSYVLP-HIDERMTRKMILMKNHQNLREEVLPFELEVGNYVSFPNHTHCSEKP 395

  Fly   406 QRKVGSMRVPPPAPPKPTIVPHTNSTISNG---SLYAVSPVQYAP--VAKPAPPAAPAKP---TS 462
               :....:.||..|.| |||     .|.|   .|.|..|....|  ...|.|...||:.   .|
 Worm   396 ---IAEAPLRPPVRPAP-IVP-----TSAGLCLVLAASFPTSSTPSRFLNPFPAPLPAESFFGNS 451

  Fly   463 RSS-AVYMTPLSAQKTQISSTPVPV------SPPPP---------------------TAASVGVP 499
            :|. |.::.|.:.|..::..|||.:      :|..|                     .|..:.:.
 Worm   452 KSKIAYFIKPTNEQPQELFQTPVQIEKIFSSTPSSPVSNAAIIDGMKNISLSDSSTSVAQDIAMK 516

  Fly   500 PPPPAP-PAGVPPAPPPMP 517
            .|.|.| .:.:..|..|:|
 Worm   517 VPTPLPRTSKIISASSPLP 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WhamyNP_001036699.1 WH2 558..>580 CDD:280384
B0280.2NP_498557.3 PH-like 23..133 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.