DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Whamy and si:dkey-197j19.6

DIOPT Version :9

Sequence 1:NP_001036699.1 Gene:Whamy / 41198 FlyBaseID:FBgn0037750 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_001919116.3 Gene:si:dkey-197j19.6 / 100149486 ZFINID:ZDB-GENE-131127-414 Length:299 Species:Danio rerio


Alignment Length:113 Identity:25/113 - (22%)
Similarity:43/113 - (38%) Gaps:30/113 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 VPHTNSTISNGSLYAV-------SPVQYAP--------VAKPAPPAAPAKPTSRSSAVYMTPLSA 474
            |||..::.|..:.::.       || |..|        :|:...|..|....:|::.:.:...::
Zfish   175 VPHPLASESKATAFSTMSGQIRDSP-QTLPSVDEESISLAQRKGPLPPIPIHARAAMLKLNRSAS 238

  Fly   475 QKTQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAG 522
            .:|..::.|||...||              ||:...|..|....|.||
Zfish   239 MQTHETTIPVPSKVPP--------------PPSYHAPTAPDKDHFSAG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WhamyNP_001036699.1 WH2 558..>580 CDD:280384
si:dkey-197j19.6XP_001919116.3 EVH1_WASP-like 27..128 CDD:269916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001481
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.