DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and YMR090W

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_013808.1 Gene:YMR090W / 855115 SGDID:S000004696 Length:227 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:42/209 - (20%)
Similarity:87/209 - (41%) Gaps:33/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIAIIGGTGMTGECAVDH-ALQKGLSVKL-LYRSEKTVPERFKSKVELVKGDVTNYE-----DVQ 60
            ::|::|.:|..|...::. ......|..| :.|::..| ..||::|. |...:|:.|     ::.
Yeast     5 KVAVVGASGKVGRLLINQLKANDSFSTPLAIVRTQDQV-NYFKNEVG-VDASLTDIENASVSEIT 67

  Fly    61 RVIEGVDAVAVILGTRNK-LEA--TTELSRGTENLIKAMKEAKLTKFSIVMSS--------FLLR 114
            ..|:..|||....|...| :|.  |.:|. |...:::|.::|.:.:|.:|.:.        :.::
Yeast    68 DAIKAYDAVVFSAGAGGKGMERIFTVDLD-GCIKVVEACEKAGIKRFVVVSALKAEDRDFWYNIK 131

  Fly   115 PLNEVPTVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPATAYTVLHDEAPGRL-----VSK 174
            .|.|........:.|       .:..:||:..:.|..:.....|......|:...:.     :::
Yeast   132 GLREYYIAKRSADRE-------VRNSNLDYTILQPGSLELNKGTGLLQPLDKLEEKASVNYSINR 189

  Fly   175 YDLGKFIIDSLEQP 188
            .|:..||::||..|
Yeast   190 EDVASFIVESLLHP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 42/209 (20%)
WcaG 3..>110 CDD:223528 28/116 (24%)
YMR090WNP_013808.1 SDR_a5 5..217 CDD:187554 42/209 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.