DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and HCF173

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001323375.1 Gene:HCF173 / 838243 AraportID:AT1G16720 Length:631 Species:Arabidopsis thaliana


Alignment Length:123 Identity:28/123 - (22%)
Similarity:53/123 - (43%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYR-SEKTVPERFKSKVELVKGDVTNYEDVQRVIEGVD 67
            :.::|.|...|...|...:.:|.:||.|.| .::.|.......|::|.|||.....::..:|...
plant   165 VLVVGATSRIGRIVVRKLMLRGYTVKALVRKQDEEVMSMLPRSVDIVVGDVGEPSTLKSAVESCS 229

  Fly    68 AVAVILGTRNKLEATTELSR----GTENLIKA----------MKEAKLTKFSIVMSSF 111
            .:......|:.:  |.:|:|    |..||.||          ::..|.:|..::::.|
plant   230 KIIYCATARSTI--TADLTRVDHLGVYNLTKAFQDYNNRLAQLRAGKSSKSKLLLAKF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 28/123 (23%)
WcaG 3..>110 CDD:223528 27/120 (23%)
HCF173NP_001323375.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.