DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and PCB2

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_197367.1 Gene:PCB2 / 831984 AraportID:AT5G18660 Length:417 Species:Arabidopsis thaliana


Alignment Length:241 Identity:57/241 - (23%)
Similarity:100/241 - (41%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVK---------GDVTNYEDV 59
            :.::|.||..|...|...:::|.:|..:.| ||:.......|.|.:|         .|||..:.:
plant    86 VLVVGSTGYIGRFVVKEMIKRGFNVIAVAR-EKSGIRGKNDKEETLKQLQGANVCFSDVTELDVL 149

  Fly    60 QRVIE----GVDAVAVILGTRN-------KLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLL 113
            ::.||    |||.|...|.:||       |::     ...|:|.:.|.|:.....|.::.:..:.
plant   150 EKSIENLGFGVDVVVSCLASRNGGIKDSWKID-----YEATKNSLVAGKKFGAKHFVLLSAICVQ 209

  Fly   114 RPLNEVPTVFHRLNEEHQ-RMLDLTKACDLDW-IAILPPHIADEPATAY--------TVLHDEAP 168
            :||.|    |.|...:.: .::||.:..|..: .:|:.|       ||:        .::.|..|
plant   210 KPLLE----FQRAKLKFEAELMDLAEQQDSSFTYSIVRP-------TAFFKSLGGQVEIVKDGKP 263

  Fly   169 ------GRL-----VSKYDLGKFIIDSLEQPEHYRKVCGIGKSPKS 203
                  |:|     :|:.||..||.|.:.:.....:|..||...|:
plant   264 YVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 54/233 (23%)
WcaG 3..>110 CDD:223528 31/125 (25%)
PCB2NP_197367.1 PLN02657 24..417 CDD:178263 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.