DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and HCF244

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_195251.1 Gene:HCF244 / 829678 AraportID:AT4G35250 Length:395 Species:Arabidopsis thaliana


Alignment Length:183 Identity:38/183 - (20%)
Similarity:59/183 - (32%) Gaps:53/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSK--VELVKGDVTNYEDVQRVIEGV 66
            |.::|.||..|...|..||.:|..|:.|.| .:..|..|...  ..:|..|::..|.:...:.|:
plant    82 ILVVGATGTLGRQIVRRALDEGYDVRCLVR-PRPAPADFLRDWGATVVNADLSKPETIPATLVGI 145

  Fly    67 DAVAVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVPTVFHRLNEEHQ 131
            ..|......|.:....|....|...||:..|...:.|:                 ||:.::.   
plant   146 HTVIDCATGRPEEPIKTVDWEGKVALIQCAKAMGIQKY-----------------VFYSIHN--- 190

  Fly   132 RMLDLTKACDLDWIAILPPHIADEPATAYTVLHDEAPGRLVSKYDLGKFIIDS 184
                    ||                     .|.|.| .:..||...||:.:|
plant   191 --------CD---------------------KHPEVP-LMEIKYCTEKFLQES 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 38/183 (21%)
WcaG 3..>110 CDD:223528 26/107 (24%)
HCF244NP_195251.1 NADB_Rossmann 81..393 CDD:419666 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.