DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and HCF244

DIOPT Version :10

Sequence 1:NP_649943.2 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_195251.1 Gene:HCF244 / 829678 AraportID:AT4G35250 Length:395 Species:Arabidopsis thaliana


Alignment Length:108 Identity:22/108 - (20%)
Similarity:44/108 - (40%) Gaps:29/108 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PIFSFKPGFLHLFVFATLISAVDPVSVLSTF-----------AELDVKKSL---FILIFGESLCN 261
            |.|:..||          ::|::.:.....|           ||.:::|.|   |.:.|..|...
plant   362 PFFTSDPG----------VNALERIKANPIFDYQLYFQEPGVAEAELEKDLERTFKVFFRGSSEK 416

  Fly   262 DAVTIVLYRTSINVIKTSD---ASDEMLTITSVVGSCVVQFMI 301
            |.:...|  |::||.:...   .:||...::|::....:|:.:
plant   417 DRLATSL--TTMNVRERGGILVGTDEDPPLSSIINEADLQYYV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_649943.2 BVR-B_like_SDR_a 3..197 CDD:187555
HCF244NP_195251.1 Rossmann-fold NAD(P)(+)-binding proteins 81..393 CDD:473865 6/40 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.