DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT4G31530

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001190881.1 Gene:AT4G31530 / 829280 AraportID:AT4G31530 Length:338 Species:Arabidopsis thaliana


Alignment Length:175 Identity:50/175 - (28%)
Similarity:84/175 - (48%) Gaps:22/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYR----SEKTVPERFKSKVELVKGDVTNYEDVQ-RVI 63
            :.::||||..|:..|...|::.:..:||.|    :.|...::.:..:::||||..|.||:. .:.
plant    76 VLVVGGTGGVGQLVVASLLKRNIRSRLLLRDLDKATKLFGKQDEYSLQVVKGDTRNAEDLDPSMF 140

  Fly    64 EGVDAVAVILGT------RNKLEATTELS--RGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVP 120
            |||..|....||      |...|.|.|..  .|.:|||.|:..:  .|..:::||..:...||:|
plant   141 EGVTHVICTTGTTAFPSKRWNEENTPEKVDWEGVKNLISALPSS--VKRVVLVSSVGVTKSNELP 203

  Fly   121 ----TVFHRLNEEHQRM-LDLTKACDLDWIAILPPHIADEPATAY 160
                .:|..|  ::::| .|..:...|.:..|.|..:.|.|.|:|
plant   204 WSIMNLFGVL--KYKKMGEDFLRDSGLPFTIIRPGRLTDGPYTSY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 50/175 (29%)
WcaG 3..>110 CDD:223528 34/118 (29%)
AT4G31530NP_001190881.1 SDR_a5 91..299 CDD:187554 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.